Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EI66

Protein Details
Accession A0A059EI66    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-25KENFYSTKKKEARKLMMRLSKPHydrophilic
NLS Segment(s)
PositionSequence
11-32KKKEARKLMMRLSKPIRDRKGK
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012971  NOG2_N_dom  
IPR027417  P-loop_NTPase  
Pfam View protein in Pfam  
PF08153  NGP1NT  
Amino Acid Sequences MKTKENFYSTKKKEARKLMMRLSKPIRDRKGKIIKCAQFQNDKAGIGKVHADRQWFSATRTIAKEDIDKLANKERELSPFDVLLSKQMLPFGLLKNKETKTKKKVNFQEVYAKQSKKIKPNFDKFLLNKENMVEKVKTEVRNENNTDSDADMDDTIQRGQSKRIWKELFKVIDCSDVVIHVLDSRDPLNTKCDLIEKYVVEKNKKLIFVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.79
3 0.77
4 0.81
5 0.81
6 0.83
7 0.77
8 0.77
9 0.74
10 0.71
11 0.7
12 0.71
13 0.7
14 0.7
15 0.72
16 0.74
17 0.77
18 0.74
19 0.76
20 0.76
21 0.73
22 0.7
23 0.73
24 0.69
25 0.66
26 0.62
27 0.61
28 0.53
29 0.48
30 0.42
31 0.36
32 0.3
33 0.22
34 0.26
35 0.2
36 0.23
37 0.24
38 0.26
39 0.25
40 0.27
41 0.32
42 0.27
43 0.27
44 0.27
45 0.27
46 0.28
47 0.29
48 0.29
49 0.24
50 0.25
51 0.25
52 0.22
53 0.24
54 0.22
55 0.21
56 0.22
57 0.29
58 0.3
59 0.28
60 0.3
61 0.28
62 0.3
63 0.33
64 0.32
65 0.24
66 0.22
67 0.22
68 0.2
69 0.18
70 0.15
71 0.13
72 0.11
73 0.1
74 0.1
75 0.1
76 0.1
77 0.12
78 0.13
79 0.16
80 0.17
81 0.18
82 0.24
83 0.26
84 0.33
85 0.38
86 0.44
87 0.47
88 0.56
89 0.61
90 0.65
91 0.71
92 0.72
93 0.69
94 0.63
95 0.64
96 0.56
97 0.56
98 0.53
99 0.45
100 0.39
101 0.44
102 0.46
103 0.45
104 0.51
105 0.55
106 0.58
107 0.66
108 0.69
109 0.64
110 0.67
111 0.59
112 0.61
113 0.55
114 0.45
115 0.38
116 0.33
117 0.33
118 0.27
119 0.3
120 0.2
121 0.16
122 0.22
123 0.26
124 0.28
125 0.28
126 0.34
127 0.36
128 0.44
129 0.46
130 0.44
131 0.4
132 0.38
133 0.35
134 0.28
135 0.23
136 0.16
137 0.13
138 0.1
139 0.09
140 0.09
141 0.09
142 0.09
143 0.1
144 0.12
145 0.12
146 0.16
147 0.21
148 0.3
149 0.34
150 0.43
151 0.47
152 0.47
153 0.52
154 0.57
155 0.58
156 0.5
157 0.5
158 0.41
159 0.4
160 0.37
161 0.32
162 0.24
163 0.17
164 0.16
165 0.12
166 0.11
167 0.09
168 0.1
169 0.09
170 0.1
171 0.11
172 0.13
173 0.15
174 0.16
175 0.18
176 0.2
177 0.2
178 0.2
179 0.25
180 0.24
181 0.27
182 0.31
183 0.29
184 0.33
185 0.37
186 0.42
187 0.43
188 0.45
189 0.48
190 0.48