Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ENC2

Protein Details
Accession A0A059ENC2   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
159-182KTVENFYCKKKSKELKGKLKGFFVHydrophilic
NLS Segment(s)
PositionSequence
169-176KSKELKGK
Subcellular Location(s) cyto 16, cyto_nucl 12, nucl 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004649  RNase_H2_suA  
IPR001352  RNase_HII/HIII  
IPR024567  RNase_HII/HIII_dom  
IPR023160  RNase_HII_hlx-loop-hlx_cap_dom  
IPR012337  RNaseH-like_sf  
IPR036397  RNaseH_sf  
Gene Ontology GO:0046872  F:metal ion binding  
GO:0003723  F:RNA binding  
GO:0004523  F:RNA-DNA hybrid ribonuclease activity  
Pfam View protein in Pfam  
PF01351  RNase_HII  
PROSITE View protein in PROSITE  
PS51975  RNASE_H_2  
Amino Acid Sequences QNFKDSKKLTPKQREMFFSEIENNFSYSYNVLTPEFLNKSMINNNLNELCFDAIFELLEECNKIYKIREIYVDTVRIPEKLQKLIKDKYKCKVTVESKADIKYKVVSGASIIAKVIRDGYIKDLNVGSGYPSDPQTVAYLKSVYDPLLGFPSFVRIKWKTVENFYCKKKSKELKGKLKGFFVGKE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.74
3 0.7
4 0.6
5 0.53
6 0.5
7 0.42
8 0.38
9 0.33
10 0.28
11 0.25
12 0.24
13 0.21
14 0.14
15 0.14
16 0.12
17 0.13
18 0.13
19 0.13
20 0.13
21 0.18
22 0.2
23 0.19
24 0.2
25 0.19
26 0.22
27 0.25
28 0.29
29 0.26
30 0.24
31 0.26
32 0.27
33 0.26
34 0.23
35 0.2
36 0.15
37 0.13
38 0.12
39 0.09
40 0.07
41 0.06
42 0.06
43 0.06
44 0.05
45 0.05
46 0.06
47 0.06
48 0.07
49 0.08
50 0.09
51 0.1
52 0.16
53 0.18
54 0.2
55 0.23
56 0.24
57 0.27
58 0.3
59 0.3
60 0.24
61 0.23
62 0.22
63 0.19
64 0.17
65 0.18
66 0.18
67 0.23
68 0.25
69 0.28
70 0.34
71 0.4
72 0.47
73 0.51
74 0.53
75 0.54
76 0.58
77 0.54
78 0.51
79 0.54
80 0.5
81 0.51
82 0.51
83 0.47
84 0.43
85 0.44
86 0.43
87 0.34
88 0.3
89 0.22
90 0.19
91 0.17
92 0.14
93 0.11
94 0.1
95 0.13
96 0.13
97 0.11
98 0.11
99 0.1
100 0.1
101 0.1
102 0.1
103 0.07
104 0.07
105 0.08
106 0.13
107 0.17
108 0.17
109 0.18
110 0.17
111 0.16
112 0.16
113 0.15
114 0.11
115 0.08
116 0.08
117 0.08
118 0.09
119 0.1
120 0.1
121 0.11
122 0.12
123 0.13
124 0.13
125 0.14
126 0.13
127 0.12
128 0.14
129 0.14
130 0.12
131 0.13
132 0.12
133 0.11
134 0.15
135 0.15
136 0.13
137 0.12
138 0.19
139 0.18
140 0.19
141 0.25
142 0.23
143 0.27
144 0.31
145 0.39
146 0.37
147 0.45
148 0.54
149 0.54
150 0.61
151 0.65
152 0.71
153 0.7
154 0.7
155 0.71
156 0.72
157 0.75
158 0.78
159 0.81
160 0.82
161 0.86
162 0.9
163 0.84
164 0.78
165 0.73