Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ELK3

Protein Details
Accession A0A059ELK3    Localization Confidence Low Confidence Score 8.4
NoLS Segment(s)
PositionSequenceProtein Nature
93-112IHDIKKTFLNEKKKKKVKNSBasic
NLS Segment(s)
PositionSequence
104-111KKKKKVKN
Subcellular Location(s) plas 8, mito 6, E.R. 5, golg 4, nucl 1, cyto 1, extr 1, cyto_nucl 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR007217  Per1-like  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0006506  P:GPI anchor biosynthetic process  
Pfam View protein in Pfam  
PF04080  Per1  
Amino Acid Sequences LIHSYNLFNNFSFFVHKFSCSTLVLFLIMSWYFTVRMRDVKYNKFLIRFILGCILSSLVEISDIPPYKYIIDSHSIYHLISAPGIIYYYKYIIHDIKKTFLNEKKKKKVKNS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.23
4 0.23
5 0.24
6 0.26
7 0.22
8 0.22
9 0.18
10 0.17
11 0.15
12 0.14
13 0.11
14 0.1
15 0.09
16 0.09
17 0.08
18 0.08
19 0.08
20 0.1
21 0.13
22 0.12
23 0.18
24 0.2
25 0.29
26 0.33
27 0.39
28 0.42
29 0.46
30 0.46
31 0.43
32 0.4
33 0.33
34 0.31
35 0.25
36 0.21
37 0.19
38 0.17
39 0.15
40 0.14
41 0.13
42 0.09
43 0.09
44 0.08
45 0.04
46 0.04
47 0.04
48 0.04
49 0.08
50 0.09
51 0.09
52 0.1
53 0.11
54 0.11
55 0.12
56 0.13
57 0.11
58 0.15
59 0.15
60 0.16
61 0.17
62 0.17
63 0.16
64 0.16
65 0.15
66 0.11
67 0.1
68 0.09
69 0.07
70 0.06
71 0.07
72 0.06
73 0.06
74 0.07
75 0.08
76 0.1
77 0.11
78 0.14
79 0.19
80 0.25
81 0.3
82 0.31
83 0.34
84 0.38
85 0.4
86 0.45
87 0.49
88 0.55
89 0.58
90 0.67
91 0.74
92 0.79