Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EK75

Protein Details
Accession A0A059EK75   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
42-64SSNIPLCNKCNKKKNTKIYCMDFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 9.5, cyto_nucl 7.5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR031502  Zf_ribonucleo  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF17026  zf-RRPl_C4  
Amino Acid Sequences MTTSCEFCHRTNTIKLNNKIYCNHCEIYISSDKTPYILNLKSSNIPLCNKCNKKKNTKIYCMDFKDYLKKLPFCKLCLEDKKLDFKYNFFKHTLFYRRVKSLIKFYYFFILIYFKNKIINFLFLLWLVRYIAYWRIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.65
3 0.67
4 0.69
5 0.67
6 0.66
7 0.62
8 0.57
9 0.53
10 0.48
11 0.38
12 0.35
13 0.32
14 0.31
15 0.34
16 0.32
17 0.26
18 0.27
19 0.27
20 0.25
21 0.25
22 0.21
23 0.19
24 0.17
25 0.2
26 0.21
27 0.23
28 0.25
29 0.26
30 0.27
31 0.25
32 0.27
33 0.27
34 0.32
35 0.39
36 0.46
37 0.52
38 0.59
39 0.63
40 0.7
41 0.77
42 0.81
43 0.8
44 0.81
45 0.8
46 0.77
47 0.78
48 0.71
49 0.64
50 0.55
51 0.47
52 0.46
53 0.39
54 0.38
55 0.33
56 0.32
57 0.31
58 0.37
59 0.38
60 0.32
61 0.36
62 0.35
63 0.39
64 0.42
65 0.45
66 0.42
67 0.42
68 0.49
69 0.46
70 0.48
71 0.4
72 0.37
73 0.42
74 0.41
75 0.42
76 0.35
77 0.34
78 0.31
79 0.38
80 0.42
81 0.38
82 0.4
83 0.42
84 0.43
85 0.46
86 0.49
87 0.45
88 0.47
89 0.48
90 0.46
91 0.42
92 0.41
93 0.42
94 0.37
95 0.33
96 0.25
97 0.21
98 0.18
99 0.21
100 0.22
101 0.18
102 0.24
103 0.24
104 0.28
105 0.26
106 0.29
107 0.26
108 0.25
109 0.25
110 0.2
111 0.22
112 0.17
113 0.16
114 0.13
115 0.12
116 0.11
117 0.12