Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EIC5

Protein Details
Accession A0A059EIC5   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-35TDTTLTLRKRRKAREAKSSTKPPTHydrophilic
NLS Segment(s)
PositionSequence
19-28RKRRKAREAK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR012340  NA-bd_OB-fold  
IPR032501  Prot_ATP_ID_OB_C  
Pfam View protein in Pfam  
PF16450  Prot_ATP_ID_OB  
Amino Acid Sequences MGQNNSSPQQNTDTTLTLRKRRKAREAKSSTKPPTVYPTTKCRLRLLNLKKMHEYLQLENSILELQDQDNKLQSKEKYAIEQIRGTPLDLGTLEEFVDDFHVIVSTGLGPEYFVYVHSFVDKDALEPGCTVLLNH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.35
3 0.4
4 0.44
5 0.5
6 0.55
7 0.61
8 0.67
9 0.75
10 0.78
11 0.8
12 0.82
13 0.83
14 0.84
15 0.84
16 0.85
17 0.8
18 0.75
19 0.67
20 0.58
21 0.57
22 0.55
23 0.51
24 0.46
25 0.49
26 0.5
27 0.53
28 0.53
29 0.5
30 0.47
31 0.47
32 0.53
33 0.52
34 0.55
35 0.56
36 0.57
37 0.55
38 0.51
39 0.47
40 0.43
41 0.38
42 0.31
43 0.29
44 0.26
45 0.25
46 0.23
47 0.21
48 0.15
49 0.12
50 0.09
51 0.05
52 0.05
53 0.09
54 0.09
55 0.09
56 0.13
57 0.14
58 0.15
59 0.19
60 0.19
61 0.2
62 0.24
63 0.25
64 0.24
65 0.29
66 0.32
67 0.3
68 0.32
69 0.28
70 0.28
71 0.27
72 0.25
73 0.2
74 0.16
75 0.14
76 0.12
77 0.13
78 0.08
79 0.08
80 0.08
81 0.07
82 0.07
83 0.06
84 0.07
85 0.06
86 0.05
87 0.05
88 0.05
89 0.05
90 0.06
91 0.06
92 0.05
93 0.05
94 0.05
95 0.05
96 0.05
97 0.05
98 0.06
99 0.06
100 0.06
101 0.09
102 0.1
103 0.11
104 0.12
105 0.12
106 0.11
107 0.15
108 0.14
109 0.12
110 0.17
111 0.17
112 0.17
113 0.17
114 0.18
115 0.15