Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EMN9

Protein Details
Accession A0A059EMN9   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
115-140NIPQNPKPRMRGRKLKREIGKKANLDHydrophilic
NLS Segment(s)
PositionSequence
120-136PKPRMRGRKLKREIGKK
Subcellular Location(s) nucl 17, mito 4, cyto 4, cyto_mito 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MNLGYSFKIIFISGMFLFLGNYLEIFDLNKVFNVAQLSNSLKFFDYSRIGDFLSNLNLPESSRKKNEDTRSKKTNSKNIQEKTSDPSKTKIIITNNIHQPGKTNEKDIRGNIPNNIPQNPKPRMRGRKLKREIGKKANLDVNEDKNLYLNNESNDSYILNAIKNYPVRFNEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.11
3 0.1
4 0.1
5 0.1
6 0.11
7 0.07
8 0.07
9 0.06
10 0.06
11 0.07
12 0.07
13 0.08
14 0.09
15 0.09
16 0.09
17 0.1
18 0.1
19 0.12
20 0.14
21 0.13
22 0.13
23 0.16
24 0.19
25 0.2
26 0.21
27 0.19
28 0.17
29 0.17
30 0.17
31 0.19
32 0.19
33 0.19
34 0.2
35 0.2
36 0.21
37 0.2
38 0.2
39 0.16
40 0.15
41 0.14
42 0.12
43 0.11
44 0.11
45 0.11
46 0.19
47 0.22
48 0.24
49 0.28
50 0.31
51 0.36
52 0.44
53 0.53
54 0.56
55 0.6
56 0.63
57 0.67
58 0.68
59 0.71
60 0.69
61 0.7
62 0.67
63 0.67
64 0.69
65 0.64
66 0.65
67 0.59
68 0.53
69 0.48
70 0.47
71 0.4
72 0.32
73 0.31
74 0.28
75 0.28
76 0.28
77 0.27
78 0.24
79 0.3
80 0.32
81 0.37
82 0.4
83 0.42
84 0.41
85 0.36
86 0.36
87 0.32
88 0.37
89 0.3
90 0.3
91 0.29
92 0.34
93 0.38
94 0.37
95 0.39
96 0.36
97 0.37
98 0.35
99 0.36
100 0.36
101 0.36
102 0.38
103 0.35
104 0.35
105 0.42
106 0.46
107 0.47
108 0.5
109 0.57
110 0.64
111 0.69
112 0.74
113 0.75
114 0.8
115 0.82
116 0.84
117 0.83
118 0.83
119 0.83
120 0.82
121 0.81
122 0.73
123 0.7
124 0.66
125 0.58
126 0.55
127 0.51
128 0.46
129 0.41
130 0.39
131 0.33
132 0.29
133 0.29
134 0.25
135 0.24
136 0.22
137 0.2
138 0.23
139 0.23
140 0.23
141 0.23
142 0.2
143 0.17
144 0.17
145 0.16
146 0.14
147 0.14
148 0.15
149 0.2
150 0.25
151 0.27
152 0.3