Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EFC0

Protein Details
Accession A0A059EFC0    Localization Confidence Low Confidence Score 6.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MSKKSVIDKHCRKRRGKNTRLTIPFNHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 22, nucl 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007590  Saf4/Yju2  
Gene Ontology GO:0000398  P:mRNA splicing, via spliceosome  
Pfam View protein in Pfam  
PF04502  Saf4_Yju2  
Amino Acid Sequences MSKKSVIDKHCRKRRGKNTRLTIPFNLMCLKCKYTLPKSKKLYANRLLSNETYLGVPIFLFEFPC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.87
4 0.86
5 0.86
6 0.87
7 0.85
8 0.8
9 0.7
10 0.65
11 0.56
12 0.47
13 0.42
14 0.32
15 0.29
16 0.26
17 0.25
18 0.2
19 0.22
20 0.27
21 0.31
22 0.4
23 0.44
24 0.51
25 0.55
26 0.62
27 0.67
28 0.69
29 0.7
30 0.69
31 0.7
32 0.64
33 0.63
34 0.58
35 0.51
36 0.45
37 0.36
38 0.28
39 0.2
40 0.16
41 0.12
42 0.09
43 0.08
44 0.07
45 0.07