Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ERV9

Protein Details
Accession A0A059ERV9    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-71RLYDSFAKKNRRKNGTRLKKNHydrophilic
NLS Segment(s)
PositionSequence
58-71KKNRRKNGTRLKKN
Subcellular Location(s) nucl 17.5, cyto_nucl 12.333, cyto 6, cyto_pero 3.833
Family & Domain DBs
Amino Acid Sequences MAECNSLEIKVEKISKDEYIITLESKKMYQINELHNVDNLELNLNVFEMARLYDSFAKKNRRKNGTRLKKN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.24
5 0.2
6 0.19
7 0.19
8 0.18
9 0.17
10 0.17
11 0.15
12 0.14
13 0.15
14 0.15
15 0.14
16 0.18
17 0.22
18 0.25
19 0.32
20 0.34
21 0.32
22 0.31
23 0.3
24 0.25
25 0.21
26 0.16
27 0.09
28 0.07
29 0.07
30 0.06
31 0.06
32 0.06
33 0.05
34 0.05
35 0.04
36 0.04
37 0.06
38 0.06
39 0.09
40 0.15
41 0.17
42 0.23
43 0.3
44 0.41
45 0.46
46 0.56
47 0.63
48 0.67
49 0.72
50 0.78
51 0.82