Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ENZ4

Protein Details
Accession A0A059ENZ4    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
123-142AGKDIHKKVKQKTENIKNKVHydrophilic
NLS Segment(s)
PositionSequence
119-134KTKSAGKDIHKKVKQK
Subcellular Location(s) nucl 17, cyto 4.5, mito 4, cyto_pero 3
Family & Domain DBs
Amino Acid Sequences MKNNKDNIQHKTNKIKDKAKETAEKVDKNIDEKFPEIKSGLKDVKQKGKEGVDAATKEAKEKFPETTSKLGEVKDKVKEGADAAKKETKNAYSEDNNLKGGNEVDMEPTKRKAHEGYEKTKSAGKDIHKKVKQKTENIKNKVDEETPKTKSKVNEVGQKIKQGAEEVKEEAKEGFPKTKAKSKEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.8
3 0.77
4 0.78
5 0.78
6 0.75
7 0.75
8 0.69
9 0.71
10 0.71
11 0.66
12 0.59
13 0.59
14 0.53
15 0.47
16 0.47
17 0.4
18 0.34
19 0.33
20 0.35
21 0.28
22 0.28
23 0.26
24 0.25
25 0.24
26 0.29
27 0.31
28 0.33
29 0.4
30 0.44
31 0.53
32 0.52
33 0.52
34 0.51
35 0.49
36 0.46
37 0.4
38 0.36
39 0.32
40 0.3
41 0.29
42 0.28
43 0.24
44 0.24
45 0.25
46 0.24
47 0.22
48 0.23
49 0.24
50 0.23
51 0.28
52 0.3
53 0.33
54 0.31
55 0.32
56 0.32
57 0.3
58 0.3
59 0.29
60 0.29
61 0.28
62 0.27
63 0.24
64 0.23
65 0.23
66 0.19
67 0.24
68 0.24
69 0.21
70 0.23
71 0.29
72 0.28
73 0.29
74 0.3
75 0.24
76 0.22
77 0.22
78 0.24
79 0.2
80 0.25
81 0.27
82 0.26
83 0.25
84 0.23
85 0.22
86 0.18
87 0.16
88 0.11
89 0.08
90 0.07
91 0.08
92 0.1
93 0.12
94 0.13
95 0.16
96 0.18
97 0.17
98 0.19
99 0.19
100 0.25
101 0.33
102 0.39
103 0.43
104 0.48
105 0.49
106 0.48
107 0.49
108 0.42
109 0.35
110 0.34
111 0.34
112 0.38
113 0.45
114 0.55
115 0.57
116 0.64
117 0.68
118 0.73
119 0.73
120 0.72
121 0.75
122 0.75
123 0.8
124 0.79
125 0.78
126 0.7
127 0.66
128 0.59
129 0.53
130 0.48
131 0.45
132 0.47
133 0.45
134 0.47
135 0.47
136 0.48
137 0.46
138 0.49
139 0.51
140 0.51
141 0.55
142 0.56
143 0.64
144 0.63
145 0.65
146 0.58
147 0.49
148 0.43
149 0.38
150 0.35
151 0.29
152 0.29
153 0.27
154 0.29
155 0.27
156 0.27
157 0.24
158 0.23
159 0.25
160 0.25
161 0.29
162 0.31
163 0.38
164 0.43
165 0.51