Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059EUJ7

Protein Details
Accession A0A059EUJ7    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
86-115IIELKKEKRIKRGKNKKLLKSKTFKKSKNFBasic
NLS Segment(s)
PositionSequence
90-113KKEKRIKRGKNKKLLKSKTFKKSK
Subcellular Location(s) nucl 13, cyto_nucl 10, mito 9, cyto 5
Family & Domain DBs
Amino Acid Sequences MKHFDKFLRYKNKNHCLPMYTFKKINRTCSGEDNQREKNGCKYEYSNLLKNKNTYLLEGLLKSLKISNENYSLLKYKIKINFKDSIIELKKEKRIKRGKNKKLLKSKTFKKSKNFAAMIRENSNTESLYYNLNELKENSFHPKLKNIYINDTIIENTLD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.73
3 0.67
4 0.67
5 0.67
6 0.64
7 0.59
8 0.57
9 0.54
10 0.59
11 0.59
12 0.61
13 0.59
14 0.58
15 0.55
16 0.58
17 0.61
18 0.6
19 0.63
20 0.61
21 0.58
22 0.57
23 0.57
24 0.51
25 0.52
26 0.49
27 0.42
28 0.39
29 0.38
30 0.38
31 0.44
32 0.47
33 0.46
34 0.46
35 0.51
36 0.5
37 0.48
38 0.45
39 0.41
40 0.37
41 0.31
42 0.26
43 0.23
44 0.22
45 0.2
46 0.19
47 0.14
48 0.13
49 0.12
50 0.12
51 0.11
52 0.12
53 0.14
54 0.16
55 0.18
56 0.2
57 0.2
58 0.2
59 0.21
60 0.19
61 0.19
62 0.17
63 0.2
64 0.25
65 0.32
66 0.33
67 0.36
68 0.4
69 0.38
70 0.4
71 0.34
72 0.36
73 0.31
74 0.31
75 0.29
76 0.28
77 0.35
78 0.39
79 0.42
80 0.44
81 0.52
82 0.6
83 0.69
84 0.76
85 0.79
86 0.83
87 0.89
88 0.88
89 0.89
90 0.88
91 0.86
92 0.85
93 0.84
94 0.84
95 0.84
96 0.81
97 0.79
98 0.78
99 0.77
100 0.77
101 0.71
102 0.64
103 0.62
104 0.61
105 0.58
106 0.53
107 0.46
108 0.37
109 0.35
110 0.33
111 0.25
112 0.2
113 0.17
114 0.14
115 0.16
116 0.15
117 0.16
118 0.17
119 0.18
120 0.18
121 0.18
122 0.21
123 0.2
124 0.23
125 0.28
126 0.33
127 0.36
128 0.37
129 0.43
130 0.45
131 0.51
132 0.55
133 0.51
134 0.51
135 0.52
136 0.5
137 0.43
138 0.39
139 0.32