Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A059ETS1

Protein Details
Accession A0A059ETS1    Localization Confidence Medium Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
21-51IVTFNKKEIKNGKKFRRKKKQNEENKSKLVTHydrophilic
NLS Segment(s)
PositionSequence
26-41KKEIKNGKKFRRKKKQ
Subcellular Location(s) nucl 16.5, cyto_nucl 12.5, cyto 7.5
Family & Domain DBs
Amino Acid Sequences DSYIENKKYFNTSEDISDKEIVTFNKKEIKNGKKFRRKKKQNEENKSKLVTEEDKEIKKEYFEFKDNEFPDLNKIEKNNFIKDTNHKERNNSEKKDSIDNNKKLKTFSDALKYNKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.31
4 0.31
5 0.28
6 0.24
7 0.26
8 0.21
9 0.25
10 0.24
11 0.24
12 0.31
13 0.31
14 0.37
15 0.44
16 0.52
17 0.56
18 0.66
19 0.73
20 0.76
21 0.85
22 0.89
23 0.91
24 0.91
25 0.92
26 0.93
27 0.93
28 0.93
29 0.94
30 0.93
31 0.89
32 0.83
33 0.73
34 0.62
35 0.52
36 0.44
37 0.36
38 0.28
39 0.27
40 0.27
41 0.26
42 0.27
43 0.28
44 0.24
45 0.22
46 0.23
47 0.21
48 0.2
49 0.23
50 0.24
51 0.24
52 0.32
53 0.32
54 0.32
55 0.27
56 0.24
57 0.24
58 0.24
59 0.23
60 0.17
61 0.18
62 0.18
63 0.25
64 0.29
65 0.3
66 0.31
67 0.32
68 0.35
69 0.42
70 0.5
71 0.52
72 0.57
73 0.55
74 0.57
75 0.63
76 0.69
77 0.71
78 0.66
79 0.62
80 0.59
81 0.6
82 0.64
83 0.62
84 0.62
85 0.63
86 0.66
87 0.69
88 0.68
89 0.67
90 0.6
91 0.56
92 0.52
93 0.47
94 0.45
95 0.46
96 0.47