Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ELF9

Protein Details
Accession A0A059ELF9   
Localization Confidence Medium
Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
195-218THNKKSSLFINKENKKKRFKNIRKHydrophilic
NLS Segment(s)
PositionSequence
190-218KKTKITHNKKSSLFINKENKKKRFKNIRK
Subcellular Location(s) nucl 17.5, cyto_nucl 12.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR025313  DUF4217  
IPR001650  Helicase_C  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005730  C:nucleolus  
GO:0005524  F:ATP binding  
GO:0004386  F:helicase activity  
GO:0016787  F:hydrolase activity  
GO:0003723  F:RNA binding  
GO:0006364  P:rRNA processing  
Pfam View protein in Pfam  
PF13959  DUF4217  
PF00271  Helicase_C  
PROSITE View protein in PROSITE  
PS51194  HELICASE_CTER  
CDD cd18787  SF2_C_DEAD  
Amino Acid Sequences ACVDYFYGLFVKMGFDLSKIHGKLRQADREKVYDNYNILFTTDVAARGIDFKDIHTVIHYDVPTDPSNFVHRTGRTGRNGKEGKVVLMLNDNESKYLQYLEVKKINISEIEDEFNNPLDFKFFNNFIDDDLINLSVKAFVSFIRSYKEHVLNYICNYKEINYNKLIQMFFLKKVPRMDELSNIRFDDFKKKTKITHNKKSSLFINKENKKKRFKNIRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.1
3 0.12
4 0.16
5 0.24
6 0.23
7 0.26
8 0.28
9 0.31
10 0.4
11 0.47
12 0.53
13 0.52
14 0.59
15 0.6
16 0.62
17 0.62
18 0.55
19 0.5
20 0.44
21 0.39
22 0.33
23 0.29
24 0.24
25 0.2
26 0.18
27 0.15
28 0.12
29 0.12
30 0.11
31 0.1
32 0.1
33 0.09
34 0.11
35 0.11
36 0.12
37 0.11
38 0.11
39 0.16
40 0.16
41 0.16
42 0.16
43 0.16
44 0.15
45 0.19
46 0.18
47 0.14
48 0.15
49 0.18
50 0.18
51 0.19
52 0.18
53 0.15
54 0.2
55 0.2
56 0.21
57 0.23
58 0.22
59 0.26
60 0.32
61 0.38
62 0.41
63 0.46
64 0.46
65 0.51
66 0.52
67 0.47
68 0.47
69 0.41
70 0.34
71 0.3
72 0.28
73 0.18
74 0.21
75 0.2
76 0.16
77 0.18
78 0.17
79 0.14
80 0.14
81 0.14
82 0.1
83 0.1
84 0.09
85 0.11
86 0.15
87 0.19
88 0.23
89 0.23
90 0.23
91 0.23
92 0.23
93 0.19
94 0.17
95 0.14
96 0.11
97 0.12
98 0.12
99 0.12
100 0.11
101 0.11
102 0.1
103 0.08
104 0.07
105 0.07
106 0.07
107 0.08
108 0.11
109 0.11
110 0.12
111 0.13
112 0.13
113 0.13
114 0.15
115 0.13
116 0.11
117 0.11
118 0.1
119 0.08
120 0.08
121 0.07
122 0.06
123 0.06
124 0.06
125 0.05
126 0.05
127 0.1
128 0.12
129 0.13
130 0.16
131 0.17
132 0.2
133 0.27
134 0.31
135 0.27
136 0.29
137 0.31
138 0.3
139 0.33
140 0.36
141 0.3
142 0.25
143 0.26
144 0.24
145 0.29
146 0.29
147 0.3
148 0.27
149 0.29
150 0.3
151 0.34
152 0.33
153 0.25
154 0.29
155 0.28
156 0.27
157 0.3
158 0.3
159 0.31
160 0.35
161 0.37
162 0.35
163 0.37
164 0.37
165 0.4
166 0.46
167 0.45
168 0.44
169 0.41
170 0.37
171 0.34
172 0.34
173 0.36
174 0.33
175 0.38
176 0.42
177 0.45
178 0.52
179 0.61
180 0.71
181 0.71
182 0.77
183 0.78
184 0.79
185 0.79
186 0.78
187 0.75
188 0.74
189 0.68
190 0.67
191 0.68
192 0.68
193 0.76
194 0.8
195 0.81
196 0.82
197 0.85
198 0.86