Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059ER17

Protein Details
Accession A0A059ER17   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
19-50CSECNNKKMKLENIRNKKRWRCTKCNKTFSLFHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, cyto_nucl 9.5, mito 7, cyto 5.5
Family & Domain DBs
Amino Acid Sequences MQNDRKLRKNNVIPSEMYCSECNNKKMKLENIRNKKRWRCTKCNKTFSLFKNTILENCKKDISEILDIIYFWSLDLTQNKAMIEGNSYSIDTIFNWYRKLKIQTYYIMINTRASKIGGIGHVVEVDEAKFSKRKYEIIRIVRSAWVVDGVDLTTGETFFVEVFYRNEDTLSQVLLDNIEGGTIVVIDC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.61
3 0.52
4 0.45
5 0.36
6 0.33
7 0.37
8 0.42
9 0.43
10 0.42
11 0.44
12 0.46
13 0.53
14 0.59
15 0.62
16 0.66
17 0.71
18 0.76
19 0.83
20 0.86
21 0.89
22 0.89
23 0.89
24 0.89
25 0.88
26 0.88
27 0.88
28 0.91
29 0.91
30 0.91
31 0.85
32 0.8
33 0.78
34 0.72
35 0.71
36 0.61
37 0.53
38 0.48
39 0.44
40 0.42
41 0.4
42 0.4
43 0.32
44 0.33
45 0.32
46 0.27
47 0.27
48 0.25
49 0.24
50 0.22
51 0.2
52 0.18
53 0.17
54 0.17
55 0.16
56 0.13
57 0.09
58 0.05
59 0.05
60 0.05
61 0.07
62 0.09
63 0.11
64 0.12
65 0.14
66 0.14
67 0.14
68 0.14
69 0.12
70 0.12
71 0.09
72 0.1
73 0.09
74 0.09
75 0.09
76 0.08
77 0.08
78 0.07
79 0.1
80 0.11
81 0.11
82 0.14
83 0.14
84 0.16
85 0.2
86 0.25
87 0.25
88 0.26
89 0.29
90 0.29
91 0.31
92 0.32
93 0.29
94 0.26
95 0.23
96 0.22
97 0.2
98 0.18
99 0.16
100 0.14
101 0.13
102 0.11
103 0.12
104 0.1
105 0.1
106 0.09
107 0.09
108 0.09
109 0.08
110 0.08
111 0.06
112 0.06
113 0.05
114 0.05
115 0.07
116 0.1
117 0.1
118 0.17
119 0.19
120 0.26
121 0.32
122 0.42
123 0.5
124 0.55
125 0.61
126 0.57
127 0.56
128 0.52
129 0.46
130 0.35
131 0.26
132 0.19
133 0.13
134 0.11
135 0.1
136 0.08
137 0.08
138 0.07
139 0.08
140 0.06
141 0.06
142 0.06
143 0.05
144 0.05
145 0.05
146 0.06
147 0.06
148 0.08
149 0.09
150 0.13
151 0.15
152 0.15
153 0.16
154 0.15
155 0.18
156 0.17
157 0.17
158 0.14
159 0.12
160 0.13
161 0.12
162 0.12
163 0.09
164 0.07
165 0.07
166 0.06
167 0.05
168 0.05