Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EJS7

Protein Details
Accession A0A059EJS7    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
29-54DPFNNEKEKKHYKRLRRCLVLQNNLNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 16, cyto_nucl 14.5, cyto 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR043128  Rev_trsase/Diguanyl_cyclase  
IPR001126  UmuC  
Gene Ontology GO:0006281  P:DNA repair  
Pfam View protein in Pfam  
PF00817  IMS  
PROSITE View protein in PROSITE  
PS50173  UMUC  
Amino Acid Sequences MDSLSEEEIALDDYKLNDDVKMSLYLSEDPFNNEKEKKHYKRLRRCLVLQNNLNASKYNFYFNKLKEDHAYLFNQQIIKKLYVHFDLDMFYAQVEMLRSGNNFPLGIGSNLMLCTCNYLAREHGVRAGMPGYLAKKLCPNLVIINPDFKRINFYSDEIMKILSLF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.13
3 0.13
4 0.11
5 0.12
6 0.13
7 0.14
8 0.15
9 0.14
10 0.13
11 0.15
12 0.17
13 0.18
14 0.19
15 0.17
16 0.2
17 0.22
18 0.23
19 0.27
20 0.27
21 0.28
22 0.35
23 0.45
24 0.48
25 0.57
26 0.64
27 0.69
28 0.78
29 0.86
30 0.87
31 0.83
32 0.82
33 0.82
34 0.82
35 0.81
36 0.73
37 0.67
38 0.62
39 0.56
40 0.5
41 0.4
42 0.32
43 0.26
44 0.22
45 0.24
46 0.19
47 0.22
48 0.28
49 0.28
50 0.36
51 0.33
52 0.35
53 0.31
54 0.34
55 0.32
56 0.29
57 0.29
58 0.22
59 0.22
60 0.22
61 0.22
62 0.18
63 0.2
64 0.19
65 0.19
66 0.19
67 0.19
68 0.19
69 0.19
70 0.19
71 0.15
72 0.13
73 0.13
74 0.12
75 0.11
76 0.08
77 0.06
78 0.05
79 0.05
80 0.05
81 0.05
82 0.05
83 0.05
84 0.06
85 0.07
86 0.08
87 0.09
88 0.09
89 0.09
90 0.08
91 0.09
92 0.1
93 0.09
94 0.09
95 0.08
96 0.08
97 0.08
98 0.08
99 0.07
100 0.06
101 0.08
102 0.08
103 0.1
104 0.11
105 0.12
106 0.13
107 0.17
108 0.19
109 0.16
110 0.19
111 0.18
112 0.17
113 0.17
114 0.16
115 0.12
116 0.1
117 0.12
118 0.11
119 0.15
120 0.15
121 0.16
122 0.21
123 0.23
124 0.24
125 0.23
126 0.24
127 0.25
128 0.29
129 0.33
130 0.29
131 0.37
132 0.35
133 0.39
134 0.38
135 0.32
136 0.36
137 0.31
138 0.35
139 0.28
140 0.3
141 0.33
142 0.34
143 0.36
144 0.29
145 0.28