Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EHM5

Protein Details
Accession A0A059EHM5    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSKGIRKHLKRLHAPKSWRLDKBasic
NLS Segment(s)
PositionSequence
7-12KHLKRL
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 6, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000876  Ribosomal_S4e  
IPR013845  Ribosomal_S4e_central_region  
IPR013843  Ribosomal_S4e_N  
IPR036986  S4_RNA-bd_sf  
Gene Ontology GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00900  Ribosomal_S4e  
PF08071  RS4NT  
PROSITE View protein in PROSITE  
PS50889  S4  
Amino Acid Sequences MSKGIRKHLKRLHAPKSWRLDKTGGKYAPMPTVGSHPRRESIPLSILLRRYLKVAPSMKELVYVLGKKIILVNGVVRTDTTYPLGIMDVLTIQSTNEHYRVMYDVFKKFVLHKIDAEESNIK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.79
3 0.81
4 0.79
5 0.71
6 0.65
7 0.62
8 0.61
9 0.61
10 0.62
11 0.52
12 0.46
13 0.47
14 0.45
15 0.41
16 0.35
17 0.28
18 0.19
19 0.25
20 0.31
21 0.32
22 0.34
23 0.33
24 0.33
25 0.33
26 0.36
27 0.31
28 0.27
29 0.25
30 0.25
31 0.25
32 0.26
33 0.26
34 0.26
35 0.25
36 0.22
37 0.21
38 0.19
39 0.17
40 0.22
41 0.25
42 0.23
43 0.26
44 0.28
45 0.25
46 0.25
47 0.24
48 0.17
49 0.16
50 0.15
51 0.11
52 0.11
53 0.11
54 0.1
55 0.11
56 0.1
57 0.08
58 0.08
59 0.1
60 0.1
61 0.11
62 0.11
63 0.1
64 0.11
65 0.12
66 0.12
67 0.12
68 0.1
69 0.09
70 0.1
71 0.1
72 0.08
73 0.07
74 0.06
75 0.05
76 0.05
77 0.05
78 0.05
79 0.05
80 0.06
81 0.09
82 0.12
83 0.12
84 0.12
85 0.12
86 0.14
87 0.16
88 0.17
89 0.2
90 0.23
91 0.25
92 0.27
93 0.28
94 0.28
95 0.29
96 0.34
97 0.34
98 0.32
99 0.32
100 0.35
101 0.4
102 0.4