Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A059EHT0

Protein Details
Accession A0A059EHT0   
Localization Confidence High
Confidence Score 15
NoLS Segment(s)
PositionSequenceProtein Nature
1-56SSNEKKNIKKTKEKLNKINKKIEKNNLKSNKKENKEKDKKDKKELKSLKKAHKLIFBasic
NLS Segment(s)
PositionSequence
5-78KKNIKKTKEKLNKINKKIEKNNLKSNKKENKEKDKKDKKELKSLKKAHKLIFKLSLKNKIKNKEIFKRDKNKII
Subcellular Location(s) nucl 19, mito 5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011004  Trimer_LpxA-like_sf  
Amino Acid Sequences SSNEKKNIKKTKEKLNKINKKIEKNNLKSNKKENKEKDKKDKKELKSLKKAHKLIFKLSLKNKIKNKEIFKRDKNKIIKYYKDKVKSITKLNDYYLLVQTDIFNSYNDSKINKDSKVNKNSKINKDSKINKDSKVNKDDKIIKDNETIKDNETIKDNAITSRESSYSDINVK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.88
3 0.9
4 0.87
5 0.9
6 0.87
7 0.87
8 0.86
9 0.86
10 0.86
11 0.82
12 0.84
13 0.84
14 0.83
15 0.8
16 0.82
17 0.81
18 0.79
19 0.82
20 0.82
21 0.82
22 0.86
23 0.89
24 0.9
25 0.9
26 0.9
27 0.9
28 0.9
29 0.84
30 0.85
31 0.84
32 0.84
33 0.83
34 0.84
35 0.83
36 0.83
37 0.83
38 0.78
39 0.76
40 0.68
41 0.63
42 0.63
43 0.58
44 0.55
45 0.55
46 0.59
47 0.57
48 0.61
49 0.63
50 0.6
51 0.63
52 0.63
53 0.67
54 0.66
55 0.7
56 0.72
57 0.74
58 0.77
59 0.75
60 0.77
61 0.75
62 0.73
63 0.73
64 0.7
65 0.69
66 0.67
67 0.71
68 0.69
69 0.67
70 0.61
71 0.57
72 0.59
73 0.55
74 0.54
75 0.51
76 0.48
77 0.44
78 0.43
79 0.42
80 0.34
81 0.31
82 0.26
83 0.2
84 0.16
85 0.14
86 0.13
87 0.1
88 0.12
89 0.1
90 0.08
91 0.1
92 0.11
93 0.13
94 0.14
95 0.15
96 0.15
97 0.21
98 0.25
99 0.25
100 0.31
101 0.39
102 0.47
103 0.56
104 0.61
105 0.61
106 0.67
107 0.75
108 0.77
109 0.77
110 0.73
111 0.68
112 0.71
113 0.74
114 0.72
115 0.73
116 0.68
117 0.62
118 0.66
119 0.69
120 0.69
121 0.69
122 0.65
123 0.58
124 0.62
125 0.67
126 0.62
127 0.61
128 0.55
129 0.48
130 0.51
131 0.54
132 0.49
133 0.45
134 0.41
135 0.35
136 0.4
137 0.38
138 0.33
139 0.31
140 0.29
141 0.27
142 0.28
143 0.27
144 0.23
145 0.23
146 0.23
147 0.21
148 0.23
149 0.22
150 0.22
151 0.23
152 0.23