Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BLD3

Protein Details
Accession A0A0D7BLD3   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
81-110DDGPGGKKERRDRRLENKKKIKERNFMSTQBasic
NLS Segment(s)
PositionSequence
85-103GGKKERRDRRLENKKKIKE
Subcellular Location(s) mito 19, nucl 5.5, cyto_nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MFRPCSVALRQTVRQTTRAYSTPAPTPAPSGRPAIAKSSCLPDTVLEGLNYLKDQPPVLAKPDSEYPDWLWNVLTPKVLPDDGPGGKKERRDRRLENKKKIKERNFMSTQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.5
3 0.47
4 0.45
5 0.43
6 0.4
7 0.36
8 0.36
9 0.37
10 0.37
11 0.36
12 0.31
13 0.33
14 0.3
15 0.3
16 0.28
17 0.26
18 0.25
19 0.25
20 0.26
21 0.27
22 0.26
23 0.25
24 0.24
25 0.26
26 0.25
27 0.23
28 0.22
29 0.16
30 0.17
31 0.17
32 0.16
33 0.11
34 0.11
35 0.1
36 0.1
37 0.1
38 0.08
39 0.08
40 0.07
41 0.07
42 0.08
43 0.11
44 0.11
45 0.15
46 0.15
47 0.13
48 0.15
49 0.2
50 0.22
51 0.19
52 0.2
53 0.19
54 0.23
55 0.23
56 0.21
57 0.17
58 0.16
59 0.19
60 0.18
61 0.17
62 0.12
63 0.13
64 0.15
65 0.15
66 0.13
67 0.12
68 0.17
69 0.19
70 0.21
71 0.22
72 0.25
73 0.28
74 0.35
75 0.43
76 0.48
77 0.53
78 0.6
79 0.68
80 0.74
81 0.83
82 0.87
83 0.88
84 0.88
85 0.91
86 0.92
87 0.93
88 0.91
89 0.9
90 0.86