Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7AYR1

Protein Details
Accession A0A0D7AYR1    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
26-52APSASAPKKKPQQQRAPKPKRTPKTAAHydrophilic
NLS Segment(s)
PositionSequence
31-49APKKKPQQQRAPKPKRTPK
Subcellular Location(s) nucl 13, cyto_nucl 11.833, cyto 9.5, mito_nucl 8.833
Family & Domain DBs
Amino Acid Sequences MKIEMVVDPSKVPAEPLSARVTPAPAPSASAPKKKPQQQRAPKPKRTPKTAADLDAEMEDYTNTNAAPAPAAATA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.19
4 0.23
5 0.22
6 0.23
7 0.22
8 0.23
9 0.19
10 0.19
11 0.18
12 0.13
13 0.15
14 0.15
15 0.23
16 0.26
17 0.32
18 0.33
19 0.38
20 0.47
21 0.53
22 0.61
23 0.62
24 0.69
25 0.73
26 0.82
27 0.86
28 0.88
29 0.89
30 0.9
31 0.9
32 0.86
33 0.83
34 0.79
35 0.72
36 0.71
37 0.66
38 0.58
39 0.51
40 0.44
41 0.37
42 0.3
43 0.26
44 0.17
45 0.13
46 0.09
47 0.08
48 0.08
49 0.07
50 0.07
51 0.06
52 0.07
53 0.07
54 0.08
55 0.08