Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7B766

Protein Details
Accession A0A0D7B766    Localization Confidence Low Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
97-125QWFCEVCKRQIQKKRKLKQPQSYLRASDKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito_nucl 9.5, cyto 7, mito 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR028651  ING_fam  
IPR019786  Zinc_finger_PHD-type_CS  
IPR011011  Znf_FYVE_PHD  
IPR001965  Znf_PHD  
IPR019787  Znf_PHD-finger  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF00628  PHD  
PROSITE View protein in PROSITE  
PS01359  ZF_PHD_1  
Amino Acid Sequences MSPVATPKPPAASHSTRQSSPPPEPVHVEPKEDAEGEEEGEEGEEDDAKEDNNPYCFCQRKKIPGDMIACVGSNCPYEWFHLSCVGLKPGQLDEGAQWFCEVCKRQIQKKRKLKQPQSYLRASDKYR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.52
3 0.47
4 0.5
5 0.53
6 0.52
7 0.5
8 0.51
9 0.45
10 0.43
11 0.47
12 0.47
13 0.5
14 0.44
15 0.43
16 0.35
17 0.34
18 0.33
19 0.28
20 0.24
21 0.17
22 0.16
23 0.13
24 0.12
25 0.09
26 0.07
27 0.07
28 0.07
29 0.05
30 0.04
31 0.04
32 0.04
33 0.05
34 0.05
35 0.05
36 0.06
37 0.08
38 0.09
39 0.11
40 0.12
41 0.14
42 0.2
43 0.25
44 0.26
45 0.33
46 0.36
47 0.42
48 0.46
49 0.5
50 0.47
51 0.48
52 0.48
53 0.41
54 0.38
55 0.29
56 0.24
57 0.18
58 0.16
59 0.1
60 0.08
61 0.08
62 0.08
63 0.08
64 0.11
65 0.14
66 0.14
67 0.15
68 0.17
69 0.17
70 0.18
71 0.19
72 0.18
73 0.16
74 0.15
75 0.15
76 0.13
77 0.14
78 0.11
79 0.1
80 0.09
81 0.14
82 0.14
83 0.13
84 0.12
85 0.12
86 0.12
87 0.18
88 0.2
89 0.17
90 0.27
91 0.34
92 0.44
93 0.54
94 0.64
95 0.69
96 0.77
97 0.84
98 0.85
99 0.89
100 0.9
101 0.91
102 0.92
103 0.92
104 0.88
105 0.85
106 0.8
107 0.76