Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W0K5

Protein Details
Accession B2W0K5    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
16-39STYNRSASPSKTKHKPRPGAASSPHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10, mito 6, extr 3, nucl 2, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR039899  BET1_SNARE  
IPR000727  T_SNARE_dom  
Gene Ontology GO:0005794  C:Golgi apparatus  
GO:0016020  C:membrane  
GO:0015031  P:protein transport  
PROSITE View protein in PROSITE  
PS50192  T_SNARE  
CDD cd15853  SNARE_Bet1  
Amino Acid Sequences MSSRFSRPDDRADLFSTYNRSASPSKTKHKPRPGAASSPYTSYGYTAPSSPAYPGSGSAASLYPGGSGSGYGVGGGEFDRRRSYDDRGGEGGAYDGGQGATFRSATPNSRGQYSAAVLDELESQNDEHVGVLTGKVRMLKDLTHLIGDEIRTSTTLAEKMNDQFENSRYKIKGTMNRMLVMAQKTGVGWKVWVGFFAAVILLFWWVWLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.4
3 0.37
4 0.31
5 0.29
6 0.25
7 0.27
8 0.26
9 0.31
10 0.38
11 0.41
12 0.49
13 0.58
14 0.68
15 0.74
16 0.82
17 0.85
18 0.83
19 0.85
20 0.82
21 0.8
22 0.74
23 0.7
24 0.6
25 0.54
26 0.48
27 0.38
28 0.33
29 0.26
30 0.22
31 0.17
32 0.17
33 0.15
34 0.14
35 0.15
36 0.15
37 0.15
38 0.15
39 0.14
40 0.13
41 0.13
42 0.14
43 0.13
44 0.12
45 0.12
46 0.11
47 0.1
48 0.1
49 0.09
50 0.06
51 0.06
52 0.06
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.04
59 0.04
60 0.04
61 0.04
62 0.04
63 0.08
64 0.08
65 0.1
66 0.12
67 0.12
68 0.16
69 0.19
70 0.24
71 0.27
72 0.3
73 0.31
74 0.31
75 0.31
76 0.26
77 0.23
78 0.18
79 0.11
80 0.08
81 0.05
82 0.04
83 0.03
84 0.03
85 0.03
86 0.03
87 0.04
88 0.04
89 0.04
90 0.06
91 0.07
92 0.09
93 0.13
94 0.19
95 0.19
96 0.2
97 0.21
98 0.2
99 0.2
100 0.19
101 0.17
102 0.11
103 0.1
104 0.09
105 0.09
106 0.1
107 0.08
108 0.07
109 0.06
110 0.06
111 0.06
112 0.07
113 0.06
114 0.04
115 0.04
116 0.05
117 0.05
118 0.06
119 0.07
120 0.07
121 0.08
122 0.1
123 0.1
124 0.11
125 0.12
126 0.12
127 0.14
128 0.18
129 0.18
130 0.16
131 0.16
132 0.15
133 0.16
134 0.16
135 0.13
136 0.1
137 0.09
138 0.09
139 0.09
140 0.09
141 0.1
142 0.12
143 0.12
144 0.12
145 0.14
146 0.17
147 0.21
148 0.21
149 0.21
150 0.21
151 0.23
152 0.3
153 0.29
154 0.33
155 0.29
156 0.3
157 0.35
158 0.4
159 0.46
160 0.46
161 0.52
162 0.49
163 0.49
164 0.48
165 0.43
166 0.4
167 0.34
168 0.27
169 0.19
170 0.17
171 0.15
172 0.18
173 0.18
174 0.14
175 0.12
176 0.14
177 0.18
178 0.17
179 0.18
180 0.17
181 0.16
182 0.15
183 0.15
184 0.12
185 0.08
186 0.08
187 0.07
188 0.06
189 0.06