Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7BRA2

Protein Details
Accession A0A0D7BRA2    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MAKSKNHTNHNQNKKAHRNGIKRPSAHydrophilic
NLS Segment(s)
PositionSequence
15-24KAHRNGIKRP
Subcellular Location(s) nucl 15.5, mito_nucl 12, mito 7.5, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR002673  Ribosomal_L29e  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01779  Ribosomal_L29e  
Amino Acid Sequences MAKSKNHTNHNQNKKAHRNGIKRPSAGRTTSMKGVDAKFRRNFRFALAGSHKARVEQKAAAAAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.83
3 0.82
4 0.81
5 0.79
6 0.81
7 0.83
8 0.8
9 0.73
10 0.67
11 0.63
12 0.57
13 0.49
14 0.43
15 0.37
16 0.33
17 0.34
18 0.31
19 0.27
20 0.25
21 0.25
22 0.3
23 0.29
24 0.34
25 0.36
26 0.43
27 0.45
28 0.45
29 0.44
30 0.39
31 0.43
32 0.36
33 0.39
34 0.38
35 0.42
36 0.42
37 0.46
38 0.42
39 0.39
40 0.43
41 0.37
42 0.36
43 0.3
44 0.31