Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7ASK6

Protein Details
Accession A0A0D7ASK6    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
9-35TQSCLNCHTSKRKCDRKRPCQRCIQLGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 21, cyto_nucl 13, mito 3, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
Amino Acid Sequences RKRRRNRTTQSCLNCHTSKRKCDRKRPCQRCIQLGLTGLCVYEIDDPALR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.66
2 0.6
3 0.61
4 0.58
5 0.59
6 0.64
7 0.7
8 0.72
9 0.8
10 0.86
11 0.86
12 0.9
13 0.9
14 0.87
15 0.86
16 0.82
17 0.78
18 0.73
19 0.65
20 0.57
21 0.52
22 0.45
23 0.36
24 0.31
25 0.24
26 0.18
27 0.14
28 0.12
29 0.1
30 0.11