Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WE03

Protein Details
Accession B2WE03    Localization Confidence Medium Confidence Score 10.8
NoLS Segment(s)
PositionSequenceProtein Nature
43-62DPVRCERRTKIPSARRQQPLHydrophilic
112-133AILKNRKKRLAARKTRDRMNLQHydrophilic
NLS Segment(s)
PositionSequence
115-127KNRKKRLAARKTR
Subcellular Location(s) mito 16.5, cyto_mito 11.5, cyto 5.5, nucl 3
Family & Domain DBs
Amino Acid Sequences MAMRRGQRRSSKLEELLPILLTIKGLDPNTSNTRAPGKPGHADPVRCERRTKIPSARRQQPLSTTHHVGHRRSTNTPFQFFELPQEIRDEVYSYLVVHQSSPRSPPILDATAILKNRKKRLAARKTRDRMNLQRLSDGKRPICPRATNTEPILHMDLVRTSQRLAHEATDCMYTKNWFAISLSKLPQPTFEIPQGWDVSRIKRLQVEVQLKDAIRMNRYIDWASFFVAFPSLQFLRIVPTLHPRYYEWARSEFCDWASIPFVHKAFFRELLAAIPRHVDLTIGVPVDTNVQLQGKVALEGKLLWDMYIELGNRVDGAGKLIPVNRVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.56
3 0.5
4 0.42
5 0.34
6 0.26
7 0.21
8 0.15
9 0.12
10 0.11
11 0.14
12 0.14
13 0.16
14 0.16
15 0.23
16 0.29
17 0.33
18 0.32
19 0.31
20 0.37
21 0.36
22 0.39
23 0.4
24 0.39
25 0.41
26 0.43
27 0.49
28 0.48
29 0.49
30 0.49
31 0.53
32 0.56
33 0.51
34 0.52
35 0.48
36 0.52
37 0.56
38 0.6
39 0.59
40 0.61
41 0.7
42 0.77
43 0.82
44 0.79
45 0.78
46 0.73
47 0.7
48 0.66
49 0.63
50 0.59
51 0.53
52 0.48
53 0.51
54 0.53
55 0.48
56 0.5
57 0.49
58 0.47
59 0.48
60 0.52
61 0.54
62 0.54
63 0.55
64 0.49
65 0.44
66 0.43
67 0.38
68 0.38
69 0.34
70 0.29
71 0.26
72 0.27
73 0.24
74 0.21
75 0.21
76 0.17
77 0.11
78 0.12
79 0.12
80 0.1
81 0.11
82 0.12
83 0.12
84 0.11
85 0.14
86 0.15
87 0.17
88 0.19
89 0.19
90 0.2
91 0.19
92 0.21
93 0.23
94 0.22
95 0.21
96 0.19
97 0.2
98 0.22
99 0.24
100 0.26
101 0.25
102 0.3
103 0.36
104 0.4
105 0.43
106 0.47
107 0.57
108 0.64
109 0.71
110 0.75
111 0.79
112 0.8
113 0.82
114 0.8
115 0.77
116 0.75
117 0.74
118 0.7
119 0.6
120 0.59
121 0.55
122 0.54
123 0.51
124 0.48
125 0.39
126 0.39
127 0.41
128 0.4
129 0.43
130 0.39
131 0.37
132 0.39
133 0.42
134 0.39
135 0.38
136 0.36
137 0.31
138 0.31
139 0.29
140 0.21
141 0.17
142 0.13
143 0.12
144 0.11
145 0.11
146 0.09
147 0.08
148 0.1
149 0.1
150 0.12
151 0.13
152 0.13
153 0.14
154 0.14
155 0.14
156 0.15
157 0.14
158 0.13
159 0.13
160 0.11
161 0.1
162 0.11
163 0.11
164 0.08
165 0.09
166 0.12
167 0.14
168 0.17
169 0.19
170 0.2
171 0.21
172 0.21
173 0.22
174 0.22
175 0.22
176 0.21
177 0.21
178 0.21
179 0.2
180 0.23
181 0.23
182 0.19
183 0.21
184 0.19
185 0.2
186 0.24
187 0.24
188 0.23
189 0.24
190 0.25
191 0.26
192 0.33
193 0.38
194 0.33
195 0.35
196 0.37
197 0.34
198 0.34
199 0.34
200 0.27
201 0.21
202 0.22
203 0.22
204 0.21
205 0.23
206 0.23
207 0.19
208 0.19
209 0.19
210 0.18
211 0.17
212 0.14
213 0.12
214 0.12
215 0.11
216 0.08
217 0.13
218 0.12
219 0.11
220 0.12
221 0.11
222 0.14
223 0.16
224 0.17
225 0.14
226 0.23
227 0.27
228 0.28
229 0.3
230 0.27
231 0.33
232 0.37
233 0.41
234 0.35
235 0.36
236 0.36
237 0.37
238 0.39
239 0.33
240 0.28
241 0.25
242 0.22
243 0.19
244 0.21
245 0.19
246 0.19
247 0.22
248 0.22
249 0.2
250 0.21
251 0.22
252 0.23
253 0.24
254 0.23
255 0.2
256 0.2
257 0.22
258 0.25
259 0.22
260 0.19
261 0.18
262 0.17
263 0.17
264 0.16
265 0.13
266 0.09
267 0.11
268 0.14
269 0.13
270 0.12
271 0.12
272 0.12
273 0.15
274 0.14
275 0.12
276 0.11
277 0.12
278 0.12
279 0.13
280 0.16
281 0.13
282 0.15
283 0.16
284 0.15
285 0.14
286 0.15
287 0.16
288 0.16
289 0.15
290 0.13
291 0.12
292 0.11
293 0.12
294 0.15
295 0.14
296 0.13
297 0.13
298 0.13
299 0.13
300 0.13
301 0.13
302 0.09
303 0.13
304 0.13
305 0.13
306 0.16
307 0.19
308 0.21