Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BKC5

Protein Details
Accession A0A0D7BKC5    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
22-63LSSLPQKKLGRPKAVDKPPSSQGFKPKRPVGRPRKHPLPVATHydrophilic
67-115RPVGRPRKHPIPEQTIKRRPGRPRRLQTPEPRVKRRPGRPRKAPAPIEEBasic
NLS Segment(s)
PositionSequence
28-110KKLGRPKAVDKPPSSQGFKPKRPVGRPRKHPLPVATPVKRPVGRPRKHPIPEQTIKRRPGRPRRLQTPEPRVKRRPGRPRKAP
Subcellular Location(s) nucl 22, cyto_nucl 14, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Amino Acid Sequences MSTWDSLVGAINTAYTANDMSLSSLPQKKLGRPKAVDKPPSSQGFKPKRPVGRPRKHPLPVATPVKRPVGRPRKHPIPEQTIKRRPGRPRRLQTPEPRVKRRPGRPRKAPAPIEEEAPYSQTAISHNATISEPNERARLPNQLQASFTGNERSSHYIQRLEERLQKSQARLEQQRHLYASETDETAHGYNRTISFLQLHYSELDEKHKRLAEAHNVLLETTMKMANDVRQAEIQESIVSRELENAKCRLHLRDEAYEGLRDILSQKEEEIRGLKTVLGSTEATVCRLDQEVLTVRAALSTQSKNGNEGDAKVDEHAQAGLQSERYAEGMSMMQDLLEEQLDFLTHLYDHWMDPFDDDLVDPDTALKNENGKRPSSRTFVGSNDYDTGAHKKARYE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.07
3 0.08
4 0.07
5 0.08
6 0.08
7 0.11
8 0.11
9 0.14
10 0.2
11 0.26
12 0.27
13 0.33
14 0.38
15 0.43
16 0.53
17 0.61
18 0.64
19 0.63
20 0.72
21 0.75
22 0.8
23 0.81
24 0.74
25 0.71
26 0.69
27 0.71
28 0.66
29 0.61
30 0.62
31 0.63
32 0.67
33 0.71
34 0.71
35 0.73
36 0.77
37 0.83
38 0.84
39 0.84
40 0.86
41 0.87
42 0.89
43 0.85
44 0.82
45 0.78
46 0.75
47 0.73
48 0.73
49 0.68
50 0.63
51 0.62
52 0.63
53 0.59
54 0.55
55 0.57
56 0.57
57 0.59
58 0.63
59 0.68
60 0.7
61 0.73
62 0.77
63 0.75
64 0.75
65 0.78
66 0.79
67 0.8
68 0.78
69 0.81
70 0.8
71 0.79
72 0.79
73 0.82
74 0.82
75 0.83
76 0.84
77 0.86
78 0.87
79 0.88
80 0.88
81 0.88
82 0.87
83 0.86
84 0.85
85 0.81
86 0.82
87 0.83
88 0.83
89 0.83
90 0.84
91 0.85
92 0.86
93 0.9
94 0.89
95 0.89
96 0.83
97 0.77
98 0.73
99 0.63
100 0.55
101 0.46
102 0.39
103 0.29
104 0.26
105 0.21
106 0.14
107 0.13
108 0.11
109 0.11
110 0.13
111 0.14
112 0.13
113 0.13
114 0.14
115 0.14
116 0.15
117 0.14
118 0.15
119 0.15
120 0.16
121 0.18
122 0.16
123 0.19
124 0.19
125 0.27
126 0.25
127 0.29
128 0.31
129 0.3
130 0.3
131 0.3
132 0.31
133 0.23
134 0.21
135 0.21
136 0.18
137 0.18
138 0.2
139 0.24
140 0.22
141 0.25
142 0.27
143 0.27
144 0.27
145 0.32
146 0.32
147 0.31
148 0.36
149 0.35
150 0.36
151 0.38
152 0.39
153 0.35
154 0.37
155 0.37
156 0.37
157 0.41
158 0.42
159 0.43
160 0.44
161 0.45
162 0.41
163 0.37
164 0.31
165 0.26
166 0.24
167 0.17
168 0.14
169 0.12
170 0.11
171 0.12
172 0.1
173 0.11
174 0.09
175 0.08
176 0.1
177 0.1
178 0.12
179 0.11
180 0.11
181 0.11
182 0.11
183 0.13
184 0.11
185 0.11
186 0.09
187 0.1
188 0.11
189 0.11
190 0.18
191 0.18
192 0.18
193 0.22
194 0.23
195 0.22
196 0.24
197 0.28
198 0.29
199 0.31
200 0.31
201 0.28
202 0.27
203 0.26
204 0.24
205 0.19
206 0.1
207 0.08
208 0.08
209 0.06
210 0.07
211 0.08
212 0.1
213 0.15
214 0.15
215 0.15
216 0.16
217 0.17
218 0.17
219 0.16
220 0.14
221 0.1
222 0.1
223 0.1
224 0.11
225 0.11
226 0.1
227 0.14
228 0.17
229 0.19
230 0.22
231 0.24
232 0.22
233 0.25
234 0.27
235 0.25
236 0.26
237 0.29
238 0.3
239 0.32
240 0.33
241 0.33
242 0.32
243 0.3
244 0.25
245 0.2
246 0.16
247 0.12
248 0.11
249 0.1
250 0.1
251 0.1
252 0.11
253 0.14
254 0.15
255 0.16
256 0.17
257 0.16
258 0.16
259 0.16
260 0.16
261 0.12
262 0.13
263 0.11
264 0.12
265 0.11
266 0.1
267 0.15
268 0.15
269 0.15
270 0.15
271 0.14
272 0.13
273 0.14
274 0.14
275 0.08
276 0.12
277 0.15
278 0.17
279 0.17
280 0.16
281 0.15
282 0.14
283 0.14
284 0.12
285 0.13
286 0.13
287 0.16
288 0.22
289 0.23
290 0.25
291 0.26
292 0.28
293 0.24
294 0.24
295 0.25
296 0.2
297 0.2
298 0.19
299 0.2
300 0.16
301 0.15
302 0.14
303 0.1
304 0.09
305 0.11
306 0.11
307 0.1
308 0.1
309 0.1
310 0.11
311 0.11
312 0.11
313 0.08
314 0.08
315 0.09
316 0.09
317 0.1
318 0.09
319 0.08
320 0.08
321 0.08
322 0.08
323 0.07
324 0.06
325 0.05
326 0.06
327 0.06
328 0.07
329 0.07
330 0.07
331 0.06
332 0.06
333 0.1
334 0.11
335 0.11
336 0.13
337 0.15
338 0.15
339 0.16
340 0.17
341 0.14
342 0.13
343 0.12
344 0.12
345 0.13
346 0.12
347 0.11
348 0.12
349 0.14
350 0.14
351 0.16
352 0.17
353 0.22
354 0.29
355 0.37
356 0.38
357 0.41
358 0.47
359 0.52
360 0.56
361 0.54
362 0.51
363 0.48
364 0.48
365 0.47
366 0.47
367 0.42
368 0.39
369 0.35
370 0.33
371 0.29
372 0.28
373 0.3
374 0.28
375 0.31