Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7B1T1

Protein Details
Accession A0A0D7B1T1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSSSSKRGRKRNDSLPPNRARDHydrophilic
NLS Segment(s)
PositionSequence
7-12RGRKRN
Subcellular Location(s) nucl 22.5, cyto_nucl 14, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Amino Acid Sequences MSSSSKRGRKRNDSLPPNRARDVQRAFRARRAAHLKDLEDRVSELERENDHLRAALGLPPANRPPLGKGPTGKDR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.87
3 0.85
4 0.8
5 0.73
6 0.68
7 0.61
8 0.59
9 0.57
10 0.55
11 0.56
12 0.59
13 0.59
14 0.59
15 0.61
16 0.52
17 0.54
18 0.53
19 0.47
20 0.45
21 0.46
22 0.42
23 0.4
24 0.41
25 0.33
26 0.26
27 0.23
28 0.18
29 0.16
30 0.15
31 0.11
32 0.12
33 0.12
34 0.16
35 0.18
36 0.17
37 0.16
38 0.16
39 0.15
40 0.13
41 0.13
42 0.12
43 0.12
44 0.14
45 0.14
46 0.18
47 0.2
48 0.22
49 0.22
50 0.2
51 0.24
52 0.32
53 0.35
54 0.36
55 0.4