Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7BGY9

Protein Details
Accession A0A0D7BGY9    Localization Confidence High Confidence Score 17.5
NoLS Segment(s)
PositionSequenceProtein Nature
183-206DEPPTNRPRTRARPPNPRITRNSTHydrophilic
211-235SQSSKNSAPKRSSSRPKSRTRTKRSHydrophilic
NLS Segment(s)
PositionSequence
173-178RKRPSP
184-235EPPTNRPRTRARPPNPRITRNSTNSKTSQSSKNSAPKRSSSRPKSRTRTKRS
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MSTPTPSMCTVDEPTLDRLNLTRRDGIANGTWTQSSLQGPVEPHMYDDWDYPQSQPLASQESEVDVGTPLITPHGSTQWLEDVLSQPASQLPESQSAGPEPFAFDDGFSQVPDDRMDCHPLPELAPAPDIAADKLQVHDSRTSTPLSRLTTPPLSITSPSPRPASPAPRYNLRKRPSPTAHPDEPPTNRPRTRARPPNPRITRNSTNSKTSQSSKNSAPKRSSSRPKSRTRTKRS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.3
4 0.26
5 0.26
6 0.31
7 0.34
8 0.35
9 0.35
10 0.33
11 0.36
12 0.36
13 0.36
14 0.33
15 0.31
16 0.28
17 0.25
18 0.24
19 0.21
20 0.21
21 0.2
22 0.17
23 0.15
24 0.15
25 0.16
26 0.17
27 0.18
28 0.2
29 0.17
30 0.17
31 0.16
32 0.17
33 0.15
34 0.16
35 0.18
36 0.17
37 0.18
38 0.17
39 0.2
40 0.19
41 0.18
42 0.18
43 0.16
44 0.19
45 0.18
46 0.18
47 0.15
48 0.15
49 0.16
50 0.14
51 0.12
52 0.08
53 0.08
54 0.07
55 0.07
56 0.05
57 0.06
58 0.06
59 0.06
60 0.07
61 0.09
62 0.1
63 0.1
64 0.11
65 0.12
66 0.13
67 0.12
68 0.12
69 0.12
70 0.12
71 0.12
72 0.11
73 0.09
74 0.1
75 0.11
76 0.11
77 0.11
78 0.11
79 0.14
80 0.16
81 0.16
82 0.15
83 0.14
84 0.14
85 0.13
86 0.11
87 0.08
88 0.07
89 0.08
90 0.08
91 0.07
92 0.07
93 0.08
94 0.08
95 0.07
96 0.08
97 0.07
98 0.08
99 0.08
100 0.08
101 0.09
102 0.1
103 0.15
104 0.14
105 0.15
106 0.15
107 0.15
108 0.15
109 0.14
110 0.14
111 0.1
112 0.1
113 0.09
114 0.08
115 0.09
116 0.09
117 0.08
118 0.07
119 0.07
120 0.07
121 0.08
122 0.1
123 0.1
124 0.11
125 0.14
126 0.15
127 0.17
128 0.18
129 0.19
130 0.18
131 0.19
132 0.22
133 0.23
134 0.24
135 0.23
136 0.27
137 0.28
138 0.27
139 0.26
140 0.23
141 0.21
142 0.2
143 0.22
144 0.23
145 0.24
146 0.26
147 0.27
148 0.25
149 0.29
150 0.33
151 0.39
152 0.39
153 0.44
154 0.45
155 0.52
156 0.6
157 0.65
158 0.68
159 0.63
160 0.65
161 0.62
162 0.69
163 0.66
164 0.68
165 0.68
166 0.67
167 0.69
168 0.63
169 0.63
170 0.61
171 0.58
172 0.56
173 0.53
174 0.54
175 0.51
176 0.53
177 0.58
178 0.6
179 0.66
180 0.69
181 0.73
182 0.76
183 0.8
184 0.86
185 0.85
186 0.84
187 0.8
188 0.79
189 0.78
190 0.75
191 0.78
192 0.72
193 0.69
194 0.64
195 0.63
196 0.59
197 0.56
198 0.57
199 0.53
200 0.54
201 0.56
202 0.63
203 0.64
204 0.66
205 0.67
206 0.67
207 0.69
208 0.74
209 0.77
210 0.77
211 0.81
212 0.83
213 0.88
214 0.9
215 0.92