Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2WA29

Protein Details
Accession B2WA29    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-58QIEPRHSRQNRQNRQNRQNRQNRQNRQNRQNRHNRQNRQNRQNRQHHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
Amino Acid Sequences MWLKPNRIKLINQIEPRHSRQNRQNRQNRQNRQNRQNRQNRQNRHNRQNRQNRQNRQH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.62
3 0.65
4 0.66
5 0.58
6 0.58
7 0.6
8 0.66
9 0.7
10 0.74
11 0.79
12 0.79
13 0.86
14 0.88
15 0.88
16 0.87
17 0.88
18 0.86
19 0.87
20 0.87
21 0.86
22 0.86
23 0.87
24 0.86
25 0.86
26 0.87
27 0.86
28 0.85
29 0.87
30 0.87
31 0.88
32 0.89
33 0.89
34 0.9
35 0.92
36 0.92
37 0.92
38 0.92