Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AQG9

Protein Details
Accession A0A0D7AQG9   
Localization Confidence High
Confidence Score 17.1
NoLS Segment(s)
PositionSequenceProtein Nature
102-140AIPRRTRRIHHEIRHHIRPRVPVRLHRRRARNGIRQAICBasic
143-174KLVPLVRRPQHSRRQSRRPTSHIRRQRFRIRQHydrophilic
NLS Segment(s)
PositionSequence
97-136LKPRLAIPRRTRRIHHEIRHHIRPRVPVRLHRRRARNGIR
147-173LVRRPQHSRRQSRRPTSHIRRQRFRIR
Subcellular Location(s) nucl 18.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
Amino Acid Sequences MATNKSKEQKKTKSSAADLQTIQYVTYCTVIKQNHTPLRHSHNTNHHRRPQAHLLRLPINTQLPLPILLTRRNIIPPQTTTLPPPTLTDLELVRRTLKPRLAIPRRTRRIHHEIRHHIRPRVPVRLHRRRARNGIRQAICIPKLVPLVRRPQHSRRQSRRPTSHIRRQRFRIRQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.74
3 0.68
4 0.64
5 0.56
6 0.49
7 0.44
8 0.35
9 0.29
10 0.21
11 0.17
12 0.12
13 0.14
14 0.13
15 0.11
16 0.17
17 0.19
18 0.23
19 0.29
20 0.38
21 0.43
22 0.45
23 0.47
24 0.46
25 0.53
26 0.57
27 0.54
28 0.52
29 0.56
30 0.63
31 0.71
32 0.74
33 0.73
34 0.74
35 0.71
36 0.71
37 0.71
38 0.7
39 0.67
40 0.61
41 0.58
42 0.54
43 0.53
44 0.47
45 0.39
46 0.31
47 0.24
48 0.21
49 0.17
50 0.13
51 0.13
52 0.12
53 0.12
54 0.13
55 0.15
56 0.17
57 0.17
58 0.18
59 0.19
60 0.2
61 0.2
62 0.21
63 0.2
64 0.22
65 0.24
66 0.23
67 0.23
68 0.25
69 0.23
70 0.2
71 0.19
72 0.17
73 0.15
74 0.15
75 0.14
76 0.12
77 0.14
78 0.15
79 0.15
80 0.15
81 0.16
82 0.17
83 0.21
84 0.23
85 0.22
86 0.27
87 0.37
88 0.43
89 0.51
90 0.58
91 0.65
92 0.7
93 0.71
94 0.69
95 0.67
96 0.69
97 0.69
98 0.67
99 0.67
100 0.7
101 0.73
102 0.8
103 0.77
104 0.71
105 0.65
106 0.67
107 0.62
108 0.61
109 0.58
110 0.57
111 0.63
112 0.7
113 0.75
114 0.74
115 0.78
116 0.76
117 0.83
118 0.83
119 0.83
120 0.81
121 0.82
122 0.75
123 0.7
124 0.65
125 0.61
126 0.52
127 0.44
128 0.34
129 0.28
130 0.31
131 0.3
132 0.32
133 0.3
134 0.39
135 0.43
136 0.51
137 0.55
138 0.6
139 0.68
140 0.73
141 0.79
142 0.79
143 0.85
144 0.88
145 0.91
146 0.91
147 0.89
148 0.9
149 0.89
150 0.89
151 0.89
152 0.89
153 0.87
154 0.88