Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BP52

Protein Details
Accession A0A0D7BP52   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
66-92FPHCSSRTLHLRRPRRPDREPRANVDPHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
Amino Acid Sequences MPSYEERKKLQEKYQIDRRHLYDYLHSRGLRVRQEDKYGNLPYRKKQTKAHKPAKVSPLGLLYPVFPHCSSRTLHLRRPRRPDREPRANVDP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.73
3 0.7
4 0.69
5 0.63
6 0.59
7 0.54
8 0.47
9 0.45
10 0.44
11 0.44
12 0.44
13 0.4
14 0.35
15 0.38
16 0.41
17 0.38
18 0.37
19 0.38
20 0.35
21 0.41
22 0.43
23 0.41
24 0.42
25 0.4
26 0.4
27 0.4
28 0.4
29 0.39
30 0.47
31 0.5
32 0.47
33 0.52
34 0.58
35 0.63
36 0.71
37 0.76
38 0.71
39 0.72
40 0.75
41 0.73
42 0.66
43 0.56
44 0.46
45 0.39
46 0.33
47 0.28
48 0.21
49 0.15
50 0.13
51 0.14
52 0.15
53 0.12
54 0.15
55 0.16
56 0.18
57 0.19
58 0.24
59 0.34
60 0.38
61 0.46
62 0.53
63 0.62
64 0.68
65 0.77
66 0.81
67 0.8
68 0.83
69 0.87
70 0.87
71 0.88
72 0.86