Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AXK6

Protein Details
Accession A0A0D7AXK6    Localization Confidence High Confidence Score 15.7
NoLS Segment(s)
PositionSequenceProtein Nature
42-63EQPVKRGRGRPKGSKNSPKKAEBasic
65-103ASDTPKRPRGRPPKPKPEGEVSTPKRPRGRPPKHPRPAABasic
NLS Segment(s)
PositionSequence
46-103KRGRGRPKGSKNSPKKAEIASDTPKRPRGRPPKPKPEGEVSTPKRPRGRPPKHPRPAA
Subcellular Location(s) nucl 21.5, cyto_nucl 13, cyto 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
IPR000116  HMGA  
Gene Ontology GO:0000785  C:chromatin  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0006355  P:regulation of DNA-templated transcription  
Amino Acid Sequences MSESPPENTTDVAEKQLDELDENPQEAADGEAAGPEEPETTEQPVKRGRGRPKGSKNSPKKAEIASDTPKRPRGRPPKPKPEGEVSTPKRPRGRPPKHPRPAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.18
5 0.15
6 0.15
7 0.16
8 0.17
9 0.17
10 0.16
11 0.13
12 0.13
13 0.12
14 0.11
15 0.06
16 0.05
17 0.05
18 0.05
19 0.06
20 0.05
21 0.05
22 0.04
23 0.05
24 0.05
25 0.07
26 0.08
27 0.11
28 0.14
29 0.15
30 0.18
31 0.23
32 0.26
33 0.3
34 0.37
35 0.43
36 0.5
37 0.56
38 0.63
39 0.68
40 0.75
41 0.78
42 0.81
43 0.81
44 0.8
45 0.79
46 0.71
47 0.64
48 0.56
49 0.5
50 0.44
51 0.41
52 0.39
53 0.41
54 0.42
55 0.44
56 0.49
57 0.49
58 0.48
59 0.52
60 0.56
61 0.6
62 0.68
63 0.74
64 0.78
65 0.82
66 0.85
67 0.8
68 0.77
69 0.72
70 0.67
71 0.67
72 0.63
73 0.66
74 0.65
75 0.67
76 0.66
77 0.65
78 0.69
79 0.7
80 0.74
81 0.74
82 0.81
83 0.85