Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BUT7

Protein Details
Accession A0A0D7BUT7    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
96-115RAKFAKTGLEVRKKKKKAKVBasic
NLS Segment(s)
PositionSequence
93-115NGSRAKFAKTGLEVRKKKKKAKV
Subcellular Location(s) mito 20, cyto 3.5, cyto_nucl 3.5, nucl 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR020934  Ribosomal_S15/S19_CS  
IPR002222  Ribosomal_S19  
IPR023575  Ribosomal_S19_S15_SF  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003723  F:RNA binding  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00203  Ribosomal_S19  
PROSITE View protein in PROSITE  
PS00323  RIBOSOMAL_S19  
Amino Acid Sequences MRPSLTALMRPTLSLLGGRSAWKGPYFVAFNMLKDAAAKNVAIKTDARACTILPNFVGIRFMVHNGKEYLPVMVTQDMVGHKLGEFSHTRKNNGSRAKFAKTGLEVRKKKKKAKV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.15
3 0.13
4 0.14
5 0.15
6 0.16
7 0.17
8 0.18
9 0.17
10 0.17
11 0.15
12 0.18
13 0.2
14 0.18
15 0.23
16 0.21
17 0.21
18 0.23
19 0.22
20 0.17
21 0.16
22 0.16
23 0.11
24 0.11
25 0.11
26 0.1
27 0.11
28 0.12
29 0.12
30 0.12
31 0.13
32 0.19
33 0.2
34 0.19
35 0.18
36 0.18
37 0.22
38 0.23
39 0.21
40 0.14
41 0.15
42 0.13
43 0.13
44 0.13
45 0.07
46 0.08
47 0.08
48 0.1
49 0.1
50 0.1
51 0.12
52 0.13
53 0.14
54 0.14
55 0.14
56 0.13
57 0.1
58 0.11
59 0.1
60 0.09
61 0.09
62 0.07
63 0.09
64 0.09
65 0.1
66 0.1
67 0.09
68 0.08
69 0.1
70 0.1
71 0.11
72 0.14
73 0.16
74 0.26
75 0.29
76 0.32
77 0.37
78 0.44
79 0.49
80 0.56
81 0.57
82 0.56
83 0.59
84 0.62
85 0.58
86 0.54
87 0.52
88 0.47
89 0.51
90 0.52
91 0.57
92 0.59
93 0.66
94 0.76
95 0.78