Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BS15

Protein Details
Accession A0A0D7BS15   
Localization Confidence Low
Confidence Score 8.6
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRIPRRRHRGKSHRLCCVSTBasic
NLS Segment(s)
PositionSequence
6-12RRRHRGK
Subcellular Location(s) mito 15.5, mito_nucl 9.333, extr 6, cyto_nucl 2.333, nucl 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR036514  SGNH_hydro_sf  
Amino Acid Sequences MGRIPRRRHRGKSHRLCCVSTSQCFALRRLTRQKVSGSVVDESYYDTQPSSTDFVAQVNKAASNRDKPDSATTLYAMYLGMEDYKRMDAATFPNVASNIAYQSLVLTSSPRAKNLLYLDSYGRGKNSTSGEEYKLNLFKSVGALHNRNVNVGFVDIGQVFDQVSADPTDTGFRGMGPCADAACDKADDFFYSEDFPSTKGHKVIADFVQAVLEECV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.85
3 0.77
4 0.69
5 0.67
6 0.62
7 0.54
8 0.5
9 0.42
10 0.44
11 0.43
12 0.42
13 0.42
14 0.41
15 0.47
16 0.52
17 0.58
18 0.56
19 0.58
20 0.6
21 0.56
22 0.56
23 0.51
24 0.43
25 0.37
26 0.33
27 0.29
28 0.25
29 0.23
30 0.21
31 0.18
32 0.15
33 0.13
34 0.12
35 0.12
36 0.14
37 0.14
38 0.11
39 0.12
40 0.12
41 0.15
42 0.18
43 0.17
44 0.17
45 0.15
46 0.17
47 0.16
48 0.2
49 0.21
50 0.25
51 0.29
52 0.3
53 0.3
54 0.31
55 0.35
56 0.34
57 0.31
58 0.25
59 0.22
60 0.19
61 0.18
62 0.16
63 0.11
64 0.08
65 0.06
66 0.05
67 0.06
68 0.05
69 0.05
70 0.06
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.1
77 0.12
78 0.13
79 0.12
80 0.13
81 0.13
82 0.13
83 0.12
84 0.1
85 0.07
86 0.07
87 0.07
88 0.06
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.13
96 0.14
97 0.14
98 0.16
99 0.15
100 0.19
101 0.21
102 0.22
103 0.16
104 0.17
105 0.17
106 0.19
107 0.2
108 0.17
109 0.15
110 0.13
111 0.12
112 0.15
113 0.16
114 0.16
115 0.18
116 0.2
117 0.23
118 0.24
119 0.24
120 0.24
121 0.25
122 0.23
123 0.2
124 0.17
125 0.15
126 0.15
127 0.17
128 0.17
129 0.2
130 0.22
131 0.22
132 0.28
133 0.27
134 0.26
135 0.24
136 0.2
137 0.15
138 0.14
139 0.13
140 0.07
141 0.09
142 0.08
143 0.08
144 0.08
145 0.07
146 0.07
147 0.07
148 0.07
149 0.05
150 0.07
151 0.06
152 0.07
153 0.07
154 0.07
155 0.09
156 0.09
157 0.1
158 0.09
159 0.09
160 0.1
161 0.1
162 0.11
163 0.1
164 0.1
165 0.09
166 0.1
167 0.1
168 0.1
169 0.12
170 0.12
171 0.11
172 0.12
173 0.13
174 0.13
175 0.14
176 0.14
177 0.13
178 0.15
179 0.15
180 0.16
181 0.15
182 0.15
183 0.18
184 0.21
185 0.24
186 0.23
187 0.25
188 0.26
189 0.29
190 0.33
191 0.32
192 0.34
193 0.3
194 0.28
195 0.27
196 0.23