Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BTJ7

Protein Details
Accession A0A0D7BTJ7    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
26-82PALARRFRSRSRGPRSPSPYWRYSSVRRGYSPPRRRPYYRTPSRHSRSRSRTPLRGGHydrophilic
NLS Segment(s)
PositionSequence
11-15RSRSP
26-82PALARRFRSRSRGPRSPSPYWRYSSVRRGYSPPRRRPYYRTPSRHSRSRSRTPLRGG
Subcellular Location(s) nucl 24, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MKNKKSLQRNRSRSPAAGPSREQETPALARRFRSRSRGPRSPSPYWRYSSVRRGYSPPRRRPYYRTPSRHSRSRSRTPLRGGYHRYRSNSPNPRGRSISRTDFARGQCSRSPRARSPLRAEASSSTLNRAPPSPVQVAPQNLQERLAKERQLAIGAMDLVKQLEAQQNISAPVRPISPAPVAKFPVRLPPSQPRADRHLSKPAPPTFVPASQSAGQGQDIAVNRENNPLPSQLAENRPASDARPQPDPPASAKIHRRFLGFDLALSEEESDMDMSDDPAKASKITETNKPDQPQVEQNFVQPRREHEDATVDVIKTDSAKEEPKDEDTYEEEDVDEVNPMAYDAQLSDCPFSESTVTSNAILMMQTQS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.72
3 0.69
4 0.66
5 0.61
6 0.55
7 0.55
8 0.52
9 0.47
10 0.38
11 0.34
12 0.34
13 0.4
14 0.43
15 0.39
16 0.43
17 0.5
18 0.56
19 0.57
20 0.6
21 0.62
22 0.66
23 0.74
24 0.79
25 0.78
26 0.81
27 0.82
28 0.83
29 0.82
30 0.79
31 0.75
32 0.69
33 0.68
34 0.65
35 0.64
36 0.65
37 0.63
38 0.62
39 0.59
40 0.62
41 0.66
42 0.71
43 0.73
44 0.74
45 0.75
46 0.77
47 0.8
48 0.81
49 0.81
50 0.81
51 0.81
52 0.8
53 0.79
54 0.82
55 0.84
56 0.84
57 0.81
58 0.8
59 0.78
60 0.8
61 0.83
62 0.8
63 0.8
64 0.78
65 0.8
66 0.76
67 0.75
68 0.73
69 0.71
70 0.72
71 0.71
72 0.68
73 0.65
74 0.65
75 0.67
76 0.69
77 0.68
78 0.67
79 0.66
80 0.67
81 0.67
82 0.63
83 0.59
84 0.55
85 0.55
86 0.49
87 0.47
88 0.44
89 0.45
90 0.43
91 0.45
92 0.39
93 0.37
94 0.37
95 0.4
96 0.44
97 0.45
98 0.51
99 0.48
100 0.57
101 0.59
102 0.62
103 0.64
104 0.66
105 0.62
106 0.55
107 0.52
108 0.44
109 0.41
110 0.38
111 0.3
112 0.24
113 0.23
114 0.23
115 0.22
116 0.22
117 0.2
118 0.18
119 0.23
120 0.23
121 0.22
122 0.23
123 0.26
124 0.27
125 0.26
126 0.31
127 0.28
128 0.25
129 0.26
130 0.26
131 0.24
132 0.27
133 0.29
134 0.24
135 0.23
136 0.25
137 0.23
138 0.22
139 0.2
140 0.15
141 0.12
142 0.11
143 0.09
144 0.07
145 0.07
146 0.05
147 0.05
148 0.05
149 0.06
150 0.09
151 0.1
152 0.1
153 0.11
154 0.12
155 0.13
156 0.14
157 0.13
158 0.1
159 0.1
160 0.1
161 0.1
162 0.09
163 0.11
164 0.14
165 0.16
166 0.17
167 0.19
168 0.21
169 0.21
170 0.23
171 0.21
172 0.26
173 0.26
174 0.25
175 0.27
176 0.34
177 0.39
178 0.43
179 0.45
180 0.4
181 0.44
182 0.49
183 0.49
184 0.44
185 0.48
186 0.44
187 0.46
188 0.5
189 0.46
190 0.44
191 0.4
192 0.41
193 0.33
194 0.34
195 0.31
196 0.24
197 0.25
198 0.22
199 0.22
200 0.18
201 0.16
202 0.14
203 0.12
204 0.11
205 0.12
206 0.11
207 0.13
208 0.15
209 0.16
210 0.16
211 0.21
212 0.21
213 0.19
214 0.19
215 0.18
216 0.15
217 0.15
218 0.17
219 0.17
220 0.21
221 0.24
222 0.23
223 0.23
224 0.24
225 0.24
226 0.22
227 0.25
228 0.26
229 0.24
230 0.29
231 0.29
232 0.31
233 0.34
234 0.35
235 0.3
236 0.32
237 0.32
238 0.33
239 0.42
240 0.45
241 0.49
242 0.49
243 0.47
244 0.43
245 0.43
246 0.45
247 0.35
248 0.28
249 0.23
250 0.23
251 0.21
252 0.19
253 0.17
254 0.08
255 0.08
256 0.08
257 0.07
258 0.05
259 0.06
260 0.06
261 0.07
262 0.09
263 0.09
264 0.09
265 0.1
266 0.11
267 0.1
268 0.11
269 0.14
270 0.19
271 0.22
272 0.31
273 0.37
274 0.43
275 0.49
276 0.51
277 0.5
278 0.45
279 0.47
280 0.48
281 0.44
282 0.44
283 0.38
284 0.41
285 0.47
286 0.47
287 0.49
288 0.41
289 0.43
290 0.45
291 0.46
292 0.42
293 0.35
294 0.39
295 0.34
296 0.38
297 0.36
298 0.28
299 0.26
300 0.24
301 0.22
302 0.17
303 0.16
304 0.13
305 0.13
306 0.19
307 0.21
308 0.25
309 0.28
310 0.32
311 0.34
312 0.32
313 0.32
314 0.3
315 0.32
316 0.29
317 0.25
318 0.21
319 0.17
320 0.17
321 0.14
322 0.12
323 0.08
324 0.07
325 0.07
326 0.07
327 0.07
328 0.06
329 0.06
330 0.06
331 0.09
332 0.12
333 0.13
334 0.15
335 0.15
336 0.18
337 0.18
338 0.19
339 0.18
340 0.16
341 0.17
342 0.2
343 0.21
344 0.18
345 0.19
346 0.18
347 0.16
348 0.15