Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7ATD8

Protein Details
Accession A0A0D7ATD8    Localization Confidence High Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
226-284VKPASRPRGAPPPRLRKRQRNTVPSEECPPPKRSRRTPCTPVIRRNPPRAAKTKGREKMHydrophilic
NLS Segment(s)
PositionSequence
229-246ASRPRGAPPPRLRKRQRN
255-291PPKRSRRTPCTPVIRRNPPRAAKTKGREKMPAPTSKR
Subcellular Location(s) nucl 16, mito 4, plas 3, cyto_mito 3
Family & Domain DBs
Amino Acid Sequences MTTPYTEDCISLTGVFGEPVGFPMHINPLDTPLRLHELASGMKPGEMIKSLYGPGNYLYLQRDFGAKIFRREYAFVPVDGTLQAMIDVYRNNQQCRYEDRARTKVNLDDLECTFVIKSASQPLFLRNPVTGIITKHAPPYPALPNIRLRTADPAMVGAKSYSQLTSLLNRPKLLRELQLVQGYFFCDHPFQWFDPPGYPVVPKPPLIAAPSWTTAFPQSSCLAQSVKPASRPRGAPPPRLRKRQRNTVPSEECPPPKRSRRTPCTPVIRRNPPRAAKTKGREKMPAPTSKR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.1
3 0.1
4 0.09
5 0.07
6 0.09
7 0.1
8 0.09
9 0.09
10 0.11
11 0.17
12 0.17
13 0.19
14 0.18
15 0.22
16 0.24
17 0.25
18 0.24
19 0.21
20 0.26
21 0.24
22 0.24
23 0.21
24 0.21
25 0.23
26 0.24
27 0.23
28 0.17
29 0.17
30 0.17
31 0.15
32 0.14
33 0.13
34 0.14
35 0.12
36 0.14
37 0.15
38 0.17
39 0.17
40 0.16
41 0.15
42 0.16
43 0.15
44 0.16
45 0.17
46 0.16
47 0.17
48 0.16
49 0.18
50 0.16
51 0.18
52 0.25
53 0.25
54 0.3
55 0.31
56 0.33
57 0.34
58 0.36
59 0.36
60 0.35
61 0.33
62 0.27
63 0.27
64 0.24
65 0.22
66 0.19
67 0.17
68 0.09
69 0.07
70 0.07
71 0.05
72 0.05
73 0.05
74 0.06
75 0.07
76 0.14
77 0.18
78 0.2
79 0.23
80 0.26
81 0.28
82 0.35
83 0.41
84 0.43
85 0.47
86 0.54
87 0.58
88 0.58
89 0.57
90 0.53
91 0.48
92 0.45
93 0.4
94 0.33
95 0.28
96 0.26
97 0.26
98 0.23
99 0.2
100 0.15
101 0.12
102 0.12
103 0.09
104 0.09
105 0.14
106 0.14
107 0.16
108 0.17
109 0.19
110 0.22
111 0.22
112 0.23
113 0.15
114 0.15
115 0.14
116 0.15
117 0.14
118 0.12
119 0.13
120 0.13
121 0.14
122 0.16
123 0.16
124 0.15
125 0.14
126 0.17
127 0.19
128 0.23
129 0.24
130 0.24
131 0.3
132 0.31
133 0.31
134 0.28
135 0.25
136 0.24
137 0.24
138 0.21
139 0.15
140 0.15
141 0.14
142 0.13
143 0.12
144 0.07
145 0.07
146 0.07
147 0.07
148 0.06
149 0.06
150 0.07
151 0.08
152 0.11
153 0.17
154 0.23
155 0.24
156 0.25
157 0.25
158 0.27
159 0.29
160 0.28
161 0.25
162 0.22
163 0.24
164 0.27
165 0.3
166 0.28
167 0.25
168 0.23
169 0.21
170 0.19
171 0.16
172 0.12
173 0.09
174 0.09
175 0.13
176 0.15
177 0.15
178 0.19
179 0.2
180 0.2
181 0.21
182 0.23
183 0.2
184 0.19
185 0.18
186 0.15
187 0.2
188 0.21
189 0.2
190 0.2
191 0.2
192 0.21
193 0.22
194 0.22
195 0.17
196 0.18
197 0.19
198 0.19
199 0.18
200 0.17
201 0.17
202 0.18
203 0.15
204 0.15
205 0.14
206 0.15
207 0.15
208 0.16
209 0.16
210 0.15
211 0.21
212 0.25
213 0.27
214 0.33
215 0.38
216 0.42
217 0.46
218 0.48
219 0.47
220 0.51
221 0.54
222 0.58
223 0.62
224 0.69
225 0.72
226 0.81
227 0.85
228 0.85
229 0.88
230 0.89
231 0.89
232 0.88
233 0.87
234 0.87
235 0.84
236 0.76
237 0.73
238 0.69
239 0.66
240 0.61
241 0.59
242 0.58
243 0.61
244 0.67
245 0.72
246 0.76
247 0.78
248 0.83
249 0.85
250 0.85
251 0.87
252 0.86
253 0.86
254 0.85
255 0.87
256 0.86
257 0.87
258 0.87
259 0.84
260 0.84
261 0.82
262 0.8
263 0.79
264 0.8
265 0.82
266 0.79
267 0.77
268 0.75
269 0.71
270 0.73
271 0.71