Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7ATD3

Protein Details
Accession A0A0D7ATD3    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
21-70DGDNNDKRREQRREQRREQRREQRREQRREQRREQRRDRRRPEQQAGYARBasic
NLS Segment(s)
PositionSequence
27-62KRREQRREQRREQRREQRREQRREQRREQRRDRRRP
Subcellular Location(s) nucl 22, mito 2, cyto 2, cyto_mito 2
Family & Domain DBs
Amino Acid Sequences MAGATATTTAEATGGSSDRSDGDNNDKRREQRREQRREQRREQRREQRREQRREQRRDRRRPEQQAGYARMGRGMSPGNTEHKGVQAGKIGSCVGMRPSPPSRIILPSAAAARMATTTSHVYRLRHRAASAVLERHARGPLLVNITCIHPKQWPRFEDATAKHPPGEPARARFTCVGSPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.09
5 0.1
6 0.12
7 0.13
8 0.15
9 0.24
10 0.32
11 0.37
12 0.43
13 0.47
14 0.53
15 0.61
16 0.67
17 0.68
18 0.7
19 0.76
20 0.8
21 0.85
22 0.89
23 0.9
24 0.91
25 0.91
26 0.91
27 0.91
28 0.9
29 0.9
30 0.9
31 0.9
32 0.9
33 0.9
34 0.9
35 0.9
36 0.9
37 0.9
38 0.9
39 0.9
40 0.91
41 0.91
42 0.91
43 0.91
44 0.93
45 0.91
46 0.91
47 0.91
48 0.9
49 0.87
50 0.84
51 0.8
52 0.77
53 0.72
54 0.66
55 0.57
56 0.46
57 0.4
58 0.32
59 0.24
60 0.18
61 0.15
62 0.11
63 0.12
64 0.14
65 0.16
66 0.17
67 0.18
68 0.16
69 0.16
70 0.18
71 0.16
72 0.16
73 0.16
74 0.15
75 0.15
76 0.15
77 0.14
78 0.11
79 0.11
80 0.1
81 0.07
82 0.08
83 0.09
84 0.13
85 0.15
86 0.18
87 0.19
88 0.21
89 0.21
90 0.22
91 0.24
92 0.2
93 0.18
94 0.17
95 0.16
96 0.14
97 0.12
98 0.09
99 0.08
100 0.07
101 0.07
102 0.05
103 0.07
104 0.1
105 0.11
106 0.17
107 0.19
108 0.21
109 0.28
110 0.36
111 0.39
112 0.38
113 0.38
114 0.34
115 0.34
116 0.38
117 0.35
118 0.3
119 0.27
120 0.27
121 0.27
122 0.27
123 0.26
124 0.19
125 0.15
126 0.16
127 0.18
128 0.21
129 0.21
130 0.21
131 0.2
132 0.24
133 0.26
134 0.24
135 0.22
136 0.22
137 0.3
138 0.38
139 0.46
140 0.45
141 0.49
142 0.52
143 0.54
144 0.57
145 0.52
146 0.49
147 0.48
148 0.48
149 0.42
150 0.4
151 0.42
152 0.39
153 0.45
154 0.44
155 0.43
156 0.51
157 0.5
158 0.52
159 0.5
160 0.48