Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2VVX0

Protein Details
Accession B2VVX0    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MAPKSPARRNKARPSRGGRVSVHydrophilic
NLS Segment(s)
PositionSequence
4-49KSPARRNKARPSRGGRVSVGSRKESGKRLGQPGPAPDRAKKRYKPG
Subcellular Location(s) nucl 14, cyto 7, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR009072  Histone-fold  
IPR007125  Histone_H2A/H2B/H3  
IPR000164  Histone_H3/CENP-A  
Gene Ontology GO:0000786  C:nucleosome  
GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
GO:0046982  F:protein heterodimerization activity  
GO:0030527  F:structural constituent of chromatin  
Pfam View protein in Pfam  
PF00125  Histone  
PROSITE View protein in PROSITE  
PS00959  HISTONE_H3_2  
Amino Acid Sequences MAPKSPARRNKARPSRGGRVSVGSRKESGKRLGQPGPAPDRAKKRYKPGTVALREIKRYQKTTDLLLLKLPFQRLVREIAQSVTTEDGPNRWQSQAIMALQEATEAFLVNLFHDANLCAIHAKRVTIQQKDIQLARRLRAAWGAPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.87
3 0.83
4 0.78
5 0.69
6 0.64
7 0.63
8 0.6
9 0.55
10 0.48
11 0.44
12 0.43
13 0.46
14 0.46
15 0.44
16 0.45
17 0.47
18 0.51
19 0.53
20 0.54
21 0.52
22 0.53
23 0.54
24 0.52
25 0.49
26 0.48
27 0.52
28 0.54
29 0.6
30 0.58
31 0.62
32 0.65
33 0.68
34 0.67
35 0.67
36 0.7
37 0.64
38 0.65
39 0.62
40 0.56
41 0.53
42 0.51
43 0.5
44 0.45
45 0.44
46 0.39
47 0.39
48 0.36
49 0.36
50 0.39
51 0.33
52 0.28
53 0.28
54 0.27
55 0.22
56 0.22
57 0.2
58 0.16
59 0.15
60 0.16
61 0.14
62 0.18
63 0.17
64 0.17
65 0.17
66 0.15
67 0.15
68 0.14
69 0.13
70 0.11
71 0.1
72 0.09
73 0.09
74 0.09
75 0.1
76 0.12
77 0.13
78 0.12
79 0.13
80 0.12
81 0.15
82 0.18
83 0.16
84 0.15
85 0.13
86 0.13
87 0.12
88 0.12
89 0.09
90 0.06
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.06
97 0.08
98 0.07
99 0.07
100 0.07
101 0.08
102 0.07
103 0.07
104 0.07
105 0.08
106 0.09
107 0.13
108 0.14
109 0.15
110 0.17
111 0.26
112 0.34
113 0.36
114 0.41
115 0.43
116 0.47
117 0.51
118 0.53
119 0.51
120 0.52
121 0.51
122 0.49
123 0.48
124 0.43
125 0.4
126 0.41