Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7B7K6

Protein Details
Accession A0A0D7B7K6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-84TYLCCSRRVTVRVKKTRRDTHydrophilic
NLS Segment(s)
Subcellular Location(s) cysk 8, mito 7, cyto 7, cyto_mito 7
Family & Domain DBs
Amino Acid Sequences MAHTDRLFFVLPKWCIYGAMNEVVRLMRRVYPISPVRSPSMVGYSAVTVLSYPNRACHCSAFYATYLCCSRRVTVRVKKTRRDT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.25
4 0.26
5 0.19
6 0.24
7 0.22
8 0.2
9 0.21
10 0.2
11 0.2
12 0.17
13 0.15
14 0.13
15 0.15
16 0.17
17 0.17
18 0.24
19 0.28
20 0.33
21 0.33
22 0.32
23 0.32
24 0.3
25 0.3
26 0.23
27 0.2
28 0.15
29 0.13
30 0.11
31 0.09
32 0.09
33 0.08
34 0.07
35 0.05
36 0.05
37 0.06
38 0.08
39 0.08
40 0.12
41 0.15
42 0.17
43 0.18
44 0.2
45 0.21
46 0.22
47 0.24
48 0.22
49 0.2
50 0.21
51 0.19
52 0.22
53 0.23
54 0.2
55 0.22
56 0.22
57 0.25
58 0.31
59 0.36
60 0.42
61 0.49
62 0.59
63 0.67
64 0.74