Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7B6A5

Protein Details
Accession A0A0D7B6A5   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
1-38MANPRQRRKSRSGSHRAVSHSKNAKRNLKKTPPIRAPLHydrophilic
NLS Segment(s)
PositionSequence
5-33RQRRKSRSGSHRAVSHSKNAKRNLKKTPP
Subcellular Location(s) nucl 12, mito 10, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019002  Ribosome_biogenesis_Nop16  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09420  Nop16  
Amino Acid Sequences MANPRQRRKSRSGSHRAVSHSKNAKRNLKKTPPIRAPLVLQKAWDPTKTVTQNYAALGLVHDLNPSASGGAEIINVDVHEEPAAPQPSSSTIETAIPQGKGRIIRDEAGNVLRIEMAEAHEEQPEEDMDVMREPDLETRDVDKWVTDLGITGARPAGKDGELVKELEKIAVRTDKAGTTLSASLTGVGPRHTSHGEKGYLVRLVDKYGKDIEKMARDRRLNPDQRTTGELRKALKRAGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.8
3 0.77
4 0.75
5 0.68
6 0.67
7 0.66
8 0.65
9 0.66
10 0.7
11 0.73
12 0.75
13 0.8
14 0.81
15 0.82
16 0.84
17 0.84
18 0.85
19 0.84
20 0.79
21 0.75
22 0.67
23 0.62
24 0.61
25 0.6
26 0.5
27 0.42
28 0.38
29 0.41
30 0.4
31 0.36
32 0.3
33 0.25
34 0.34
35 0.37
36 0.36
37 0.33
38 0.33
39 0.34
40 0.31
41 0.3
42 0.21
43 0.17
44 0.15
45 0.13
46 0.11
47 0.09
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.05
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.05
62 0.05
63 0.06
64 0.06
65 0.06
66 0.05
67 0.05
68 0.06
69 0.12
70 0.14
71 0.13
72 0.13
73 0.13
74 0.16
75 0.19
76 0.18
77 0.13
78 0.12
79 0.13
80 0.14
81 0.16
82 0.16
83 0.13
84 0.13
85 0.13
86 0.15
87 0.17
88 0.17
89 0.19
90 0.18
91 0.19
92 0.19
93 0.19
94 0.19
95 0.16
96 0.17
97 0.13
98 0.11
99 0.1
100 0.09
101 0.08
102 0.07
103 0.07
104 0.06
105 0.07
106 0.08
107 0.08
108 0.08
109 0.08
110 0.08
111 0.07
112 0.06
113 0.06
114 0.05
115 0.05
116 0.06
117 0.06
118 0.05
119 0.05
120 0.05
121 0.07
122 0.09
123 0.1
124 0.1
125 0.13
126 0.14
127 0.15
128 0.14
129 0.12
130 0.11
131 0.1
132 0.09
133 0.06
134 0.05
135 0.06
136 0.08
137 0.07
138 0.07
139 0.08
140 0.09
141 0.09
142 0.09
143 0.1
144 0.08
145 0.1
146 0.11
147 0.14
148 0.15
149 0.16
150 0.15
151 0.16
152 0.16
153 0.16
154 0.16
155 0.13
156 0.15
157 0.19
158 0.19
159 0.18
160 0.2
161 0.19
162 0.19
163 0.2
164 0.16
165 0.14
166 0.15
167 0.14
168 0.13
169 0.12
170 0.11
171 0.11
172 0.12
173 0.1
174 0.1
175 0.11
176 0.11
177 0.15
178 0.17
179 0.19
180 0.22
181 0.28
182 0.28
183 0.28
184 0.3
185 0.3
186 0.3
187 0.28
188 0.27
189 0.22
190 0.24
191 0.28
192 0.27
193 0.26
194 0.3
195 0.31
196 0.29
197 0.33
198 0.35
199 0.39
200 0.45
201 0.5
202 0.52
203 0.55
204 0.59
205 0.64
206 0.69
207 0.68
208 0.68
209 0.7
210 0.66
211 0.65
212 0.65
213 0.62
214 0.59
215 0.57
216 0.55
217 0.51
218 0.53
219 0.55