Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7BUS6

Protein Details
Accession A0A0D7BUS6    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
50-69QPSQRVRKRRHGFLARLRSKBasic
NLS Segment(s)
PositionSequence
54-84RVRKRRHGFLARLRSKGGRKILERRKAKGRK
Subcellular Location(s) mito 17, nucl 5, extr 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences AAARFTAAPAILTKPTSFLSAFLTHPVFPPNSVLGSLQQLRFKARGNEYQPSQRVRKRRHGFLARLRSKGGRKILERRKAKGRKYLTH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.17
3 0.18
4 0.17
5 0.15
6 0.17
7 0.19
8 0.19
9 0.2
10 0.21
11 0.19
12 0.19
13 0.21
14 0.16
15 0.14
16 0.16
17 0.13
18 0.12
19 0.13
20 0.12
21 0.11
22 0.14
23 0.17
24 0.17
25 0.18
26 0.18
27 0.19
28 0.2
29 0.21
30 0.22
31 0.23
32 0.29
33 0.31
34 0.35
35 0.36
36 0.42
37 0.44
38 0.43
39 0.47
40 0.44
41 0.49
42 0.52
43 0.6
44 0.6
45 0.65
46 0.71
47 0.73
48 0.76
49 0.77
50 0.81
51 0.76
52 0.71
53 0.65
54 0.61
55 0.57
56 0.56
57 0.54
58 0.5
59 0.52
60 0.6
61 0.68
62 0.72
63 0.74
64 0.73
65 0.76
66 0.77
67 0.78
68 0.77