Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BE56

Protein Details
Accession A0A0D7BE56    Localization Confidence Medium Confidence Score 12.8
NoLS Segment(s)
PositionSequenceProtein Nature
1-20MPKVARTRKRPAQTQAPVPLHydrophilic
169-194TADTMYIRTKDKKKRVKVRVPEGLPFHydrophilic
NLS Segment(s)
PositionSequence
180-185KKKRVK
Subcellular Location(s) mito_nucl 11, nucl 10.5, mito 10.5, cyto 6
Family & Domain DBs
Amino Acid Sequences MPKVARTRKRPAQTQAPVPLNRPMTAPERALYQTIMSGEHNMSFEEVAAKPTIIDIFECKIEGFNLDFVAAMDKLFNIGQLADSDEEDIRDDPIDEPWEGAPFQITDVKLAGHTLHIKWWRDPINPMCNGAKHYFFGITCDDKSFKYDTLEFPLFGDELVDIGFPTLTTADTMYIRTKDKKKRVKVRVPEGLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.79
3 0.77
4 0.71
5 0.64
6 0.63
7 0.54
8 0.47
9 0.39
10 0.33
11 0.3
12 0.32
13 0.31
14 0.24
15 0.26
16 0.26
17 0.26
18 0.23
19 0.19
20 0.17
21 0.15
22 0.16
23 0.13
24 0.14
25 0.13
26 0.14
27 0.14
28 0.12
29 0.12
30 0.11
31 0.1
32 0.11
33 0.1
34 0.1
35 0.1
36 0.1
37 0.09
38 0.1
39 0.1
40 0.07
41 0.08
42 0.08
43 0.09
44 0.1
45 0.1
46 0.1
47 0.1
48 0.1
49 0.1
50 0.09
51 0.08
52 0.08
53 0.08
54 0.08
55 0.07
56 0.09
57 0.07
58 0.06
59 0.06
60 0.05
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.05
67 0.05
68 0.07
69 0.06
70 0.06
71 0.07
72 0.07
73 0.07
74 0.08
75 0.08
76 0.07
77 0.06
78 0.07
79 0.06
80 0.07
81 0.09
82 0.08
83 0.08
84 0.08
85 0.09
86 0.08
87 0.08
88 0.07
89 0.05
90 0.06
91 0.09
92 0.09
93 0.08
94 0.09
95 0.09
96 0.08
97 0.09
98 0.08
99 0.07
100 0.09
101 0.09
102 0.14
103 0.2
104 0.21
105 0.22
106 0.28
107 0.3
108 0.3
109 0.37
110 0.38
111 0.41
112 0.4
113 0.42
114 0.38
115 0.35
116 0.36
117 0.32
118 0.27
119 0.2
120 0.2
121 0.18
122 0.17
123 0.18
124 0.18
125 0.19
126 0.18
127 0.2
128 0.2
129 0.19
130 0.22
131 0.22
132 0.19
133 0.21
134 0.23
135 0.22
136 0.29
137 0.3
138 0.27
139 0.25
140 0.25
141 0.21
142 0.18
143 0.16
144 0.07
145 0.06
146 0.06
147 0.06
148 0.04
149 0.04
150 0.05
151 0.04
152 0.05
153 0.05
154 0.05
155 0.06
156 0.07
157 0.08
158 0.09
159 0.12
160 0.16
161 0.19
162 0.24
163 0.32
164 0.41
165 0.49
166 0.6
167 0.68
168 0.75
169 0.82
170 0.88
171 0.91
172 0.92
173 0.92
174 0.92