Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BRD7

Protein Details
Accession A0A0D7BRD7   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
2-27AVKIPIVKKRTKVFKRHQSDRYHSVKHydrophilic
NLS Segment(s)
PositionSequence
9-20KKRTKVFKRHQS
22-22R
24-43HSVKEAWRKPKGIDNRVRRR
Subcellular Location(s) mito 13.5, mito_nucl 12.833, nucl 11, cyto_nucl 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAVKIPIVKKRTKVFKRHQSDRYHSVKEAWRKPKGIDNRVRRRFSGQTAMPKIGYGSNKRTRHMLPSGLKKFVVNNAREVDLLLMHNKTYAAEIAHNVSSRNRTVILERAKALGIKVTNSAARLRSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.86
4 0.88
5 0.87
6 0.86
7 0.84
8 0.83
9 0.79
10 0.73
11 0.64
12 0.6
13 0.59
14 0.59
15 0.61
16 0.61
17 0.59
18 0.57
19 0.58
20 0.61
21 0.63
22 0.64
23 0.64
24 0.66
25 0.71
26 0.78
27 0.78
28 0.71
29 0.67
30 0.61
31 0.57
32 0.54
33 0.48
34 0.48
35 0.48
36 0.48
37 0.42
38 0.37
39 0.33
40 0.28
41 0.27
42 0.22
43 0.27
44 0.35
45 0.37
46 0.38
47 0.41
48 0.39
49 0.4
50 0.39
51 0.38
52 0.35
53 0.42
54 0.45
55 0.43
56 0.42
57 0.36
58 0.34
59 0.33
60 0.34
61 0.25
62 0.26
63 0.26
64 0.27
65 0.26
66 0.25
67 0.19
68 0.13
69 0.13
70 0.1
71 0.09
72 0.08
73 0.09
74 0.09
75 0.08
76 0.08
77 0.09
78 0.08
79 0.09
80 0.1
81 0.13
82 0.14
83 0.15
84 0.15
85 0.17
86 0.19
87 0.19
88 0.2
89 0.19
90 0.18
91 0.21
92 0.29
93 0.33
94 0.33
95 0.33
96 0.33
97 0.32
98 0.31
99 0.29
100 0.26
101 0.2
102 0.18
103 0.19
104 0.21
105 0.22
106 0.23
107 0.26
108 0.23