Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7AY37

Protein Details
Accession A0A0D7AY37   
Localization Confidence High
Confidence Score 20.9
NoLS Segment(s)
PositionSequenceProtein Nature
4-29APAATPAPKTRKPRKPSAVTGTRKNIHydrophilic
98-119QNTLAARKSRKRKLEHQRGLETHydrophilic
NLS Segment(s)
PositionSequence
12-18KTRKPRK
103-110ARKSRKRK
Subcellular Location(s) nucl 24, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR004827  bZIP  
IPR046347  bZIP_sf  
Gene Ontology GO:0003700  F:DNA-binding transcription factor activity  
Pfam View protein in Pfam  
PF07716  bZIP_2  
PROSITE View protein in PROSITE  
PS00036  BZIP_BASIC  
CDD cd12193  bZIP_GCN4  
Amino Acid Sequences MSPAPAATPAPKTRKPRKPSAVTGTRKNISPETMVSMEAPTQTRKYQAPSATSRKELPATFLKKKRARSEAFGDDDEPEEILPPNATEMEQIEFKRRQNTLAARKSRKRKLEHQRGLETQLEELRAQLTHWKTRAELSEGVLKEKGLSVPSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.71
2 0.75
3 0.79
4 0.81
5 0.82
6 0.84
7 0.84
8 0.84
9 0.81
10 0.82
11 0.79
12 0.71
13 0.64
14 0.58
15 0.5
16 0.42
17 0.37
18 0.3
19 0.27
20 0.26
21 0.24
22 0.21
23 0.19
24 0.17
25 0.16
26 0.17
27 0.14
28 0.15
29 0.16
30 0.19
31 0.2
32 0.24
33 0.28
34 0.31
35 0.34
36 0.39
37 0.47
38 0.47
39 0.47
40 0.44
41 0.4
42 0.39
43 0.34
44 0.31
45 0.31
46 0.35
47 0.41
48 0.45
49 0.53
50 0.55
51 0.62
52 0.65
53 0.64
54 0.6
55 0.57
56 0.58
57 0.55
58 0.53
59 0.46
60 0.39
61 0.31
62 0.28
63 0.23
64 0.15
65 0.09
66 0.06
67 0.06
68 0.05
69 0.05
70 0.04
71 0.05
72 0.05
73 0.05
74 0.05
75 0.06
76 0.07
77 0.1
78 0.11
79 0.16
80 0.19
81 0.21
82 0.27
83 0.26
84 0.26
85 0.31
86 0.4
87 0.44
88 0.51
89 0.58
90 0.61
91 0.7
92 0.78
93 0.79
94 0.78
95 0.75
96 0.76
97 0.78
98 0.81
99 0.82
100 0.81
101 0.8
102 0.74
103 0.71
104 0.64
105 0.54
106 0.44
107 0.36
108 0.3
109 0.22
110 0.2
111 0.16
112 0.12
113 0.12
114 0.18
115 0.21
116 0.26
117 0.29
118 0.3
119 0.3
120 0.35
121 0.39
122 0.36
123 0.33
124 0.29
125 0.35
126 0.34
127 0.36
128 0.32
129 0.27
130 0.23
131 0.23
132 0.22