Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7AZE0

Protein Details
Accession A0A0D7AZE0    Localization Confidence Low Confidence Score 5.8
NoLS Segment(s)
PositionSequenceProtein Nature
51-76NDAAHRPRLTPKTRTKKAPNPEYTPIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12, mito 10, nucl 2, pero 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR029058  AB_hydrolase  
IPR000073  AB_hydrolase_1  
IPR016812  PPase_methylesterase_euk  
Gene Ontology GO:0051723  F:protein methylesterase activity  
GO:0006482  P:protein demethylation  
Pfam View protein in Pfam  
PF12697  Abhydrolase_6  
Amino Acid Sequences MSDLYRNAMNARLAKLPATLPGDDGDEEEEETDGLGALPGQGLGPPAMFLNDAAHRPRLTPKTRTKKAPNPEYTPISAATYFEQALMVEVPERGLDFRVYYTPPKTADGAVMVCHHGAGYSGLSFACMAQEIVTMTKGECGVLSVDARRHGRTTAMESHDDSDLSEVSLVQDFAALVKTFFKDPATAPVLILVGHSMGGSVVVRACPLILESKFHVAGVAVLDIVEGSALDALPHMNSILNARPDGFDSPEEAIEWHLNTKAIRNPLSARVSVPNIIKPSDSTSPLVPAYVWRTPLRLTAPFWRSWFEGLSANFLICRTARLLVLAGTDRLDKELMIGQMQGKFQLIVIPSVGHLLHEDDPRGTAETLVEFWRRNERIKLPIKVKKVGEL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.31
3 0.27
4 0.28
5 0.28
6 0.26
7 0.22
8 0.22
9 0.24
10 0.21
11 0.21
12 0.17
13 0.14
14 0.14
15 0.13
16 0.12
17 0.09
18 0.09
19 0.08
20 0.06
21 0.05
22 0.05
23 0.04
24 0.04
25 0.05
26 0.04
27 0.04
28 0.05
29 0.06
30 0.06
31 0.06
32 0.06
33 0.07
34 0.07
35 0.08
36 0.08
37 0.11
38 0.13
39 0.17
40 0.2
41 0.23
42 0.23
43 0.25
44 0.33
45 0.39
46 0.43
47 0.49
48 0.58
49 0.65
50 0.73
51 0.81
52 0.82
53 0.82
54 0.86
55 0.87
56 0.85
57 0.81
58 0.8
59 0.75
60 0.66
61 0.59
62 0.49
63 0.41
64 0.32
65 0.26
66 0.2
67 0.17
68 0.15
69 0.13
70 0.12
71 0.1
72 0.1
73 0.1
74 0.08
75 0.07
76 0.07
77 0.07
78 0.07
79 0.07
80 0.07
81 0.08
82 0.08
83 0.08
84 0.1
85 0.13
86 0.15
87 0.19
88 0.21
89 0.23
90 0.25
91 0.26
92 0.26
93 0.23
94 0.22
95 0.2
96 0.18
97 0.16
98 0.15
99 0.14
100 0.12
101 0.11
102 0.1
103 0.07
104 0.07
105 0.07
106 0.06
107 0.05
108 0.06
109 0.06
110 0.07
111 0.07
112 0.06
113 0.05
114 0.05
115 0.05
116 0.04
117 0.05
118 0.06
119 0.06
120 0.07
121 0.07
122 0.07
123 0.08
124 0.08
125 0.07
126 0.07
127 0.07
128 0.07
129 0.08
130 0.09
131 0.09
132 0.11
133 0.16
134 0.18
135 0.18
136 0.19
137 0.18
138 0.2
139 0.2
140 0.24
141 0.26
142 0.28
143 0.28
144 0.28
145 0.29
146 0.27
147 0.25
148 0.19
149 0.13
150 0.09
151 0.08
152 0.07
153 0.05
154 0.05
155 0.06
156 0.06
157 0.05
158 0.05
159 0.04
160 0.05
161 0.06
162 0.06
163 0.05
164 0.07
165 0.08
166 0.08
167 0.09
168 0.09
169 0.09
170 0.1
171 0.16
172 0.17
173 0.17
174 0.16
175 0.16
176 0.16
177 0.14
178 0.13
179 0.07
180 0.04
181 0.04
182 0.04
183 0.03
184 0.03
185 0.03
186 0.03
187 0.03
188 0.03
189 0.03
190 0.04
191 0.04
192 0.04
193 0.03
194 0.04
195 0.08
196 0.08
197 0.1
198 0.11
199 0.14
200 0.14
201 0.14
202 0.13
203 0.09
204 0.09
205 0.08
206 0.07
207 0.04
208 0.04
209 0.04
210 0.04
211 0.04
212 0.03
213 0.02
214 0.02
215 0.02
216 0.02
217 0.02
218 0.03
219 0.03
220 0.03
221 0.03
222 0.04
223 0.04
224 0.04
225 0.06
226 0.1
227 0.11
228 0.12
229 0.12
230 0.12
231 0.14
232 0.15
233 0.15
234 0.12
235 0.13
236 0.14
237 0.13
238 0.13
239 0.12
240 0.12
241 0.11
242 0.11
243 0.1
244 0.09
245 0.1
246 0.11
247 0.14
248 0.17
249 0.22
250 0.23
251 0.25
252 0.27
253 0.33
254 0.36
255 0.33
256 0.31
257 0.29
258 0.29
259 0.31
260 0.3
261 0.26
262 0.25
263 0.25
264 0.23
265 0.21
266 0.24
267 0.23
268 0.24
269 0.22
270 0.21
271 0.23
272 0.23
273 0.22
274 0.16
275 0.16
276 0.19
277 0.19
278 0.22
279 0.2
280 0.22
281 0.23
282 0.27
283 0.28
284 0.26
285 0.27
286 0.33
287 0.36
288 0.38
289 0.38
290 0.37
291 0.34
292 0.32
293 0.3
294 0.23
295 0.24
296 0.21
297 0.25
298 0.22
299 0.21
300 0.19
301 0.18
302 0.18
303 0.12
304 0.14
305 0.11
306 0.12
307 0.12
308 0.13
309 0.14
310 0.13
311 0.16
312 0.15
313 0.14
314 0.14
315 0.15
316 0.14
317 0.15
318 0.14
319 0.11
320 0.11
321 0.15
322 0.15
323 0.15
324 0.16
325 0.17
326 0.21
327 0.21
328 0.2
329 0.17
330 0.16
331 0.15
332 0.17
333 0.15
334 0.13
335 0.13
336 0.13
337 0.12
338 0.14
339 0.14
340 0.1
341 0.1
342 0.13
343 0.17
344 0.19
345 0.21
346 0.19
347 0.21
348 0.22
349 0.24
350 0.21
351 0.16
352 0.15
353 0.15
354 0.17
355 0.2
356 0.22
357 0.2
358 0.23
359 0.32
360 0.34
361 0.39
362 0.45
363 0.47
364 0.54
365 0.62
366 0.68
367 0.68
368 0.74
369 0.75
370 0.75