Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7BTI8

Protein Details
Accession A0A0D7BTI8    Localization Confidence Medium Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
75-95YEEKQQRKKEKEEEKKRAKESBasic
NLS Segment(s)
PositionSequence
80-103QRKKEKEEEKKRAKESEGKEEGKK
Subcellular Location(s) mito 16, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MSFTNVYYKRTAATARPCYVCHKPTPVVLATVNTVDFIYSCESHLKDRGFATQIQDEQAKPAVSADEIARVKAEYEEKQQRKKEKEEEKKRAKESEGKEEGKKDEETAKTKSPTPTPTSPSPSQTPSATHQKYSLHRDYFTMRQDEHRRKRQAAQAKELAPRLPGAPRGAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.47
3 0.48
4 0.49
5 0.52
6 0.57
7 0.53
8 0.49
9 0.47
10 0.44
11 0.44
12 0.47
13 0.42
14 0.37
15 0.33
16 0.29
17 0.23
18 0.21
19 0.18
20 0.14
21 0.12
22 0.09
23 0.08
24 0.08
25 0.1
26 0.1
27 0.11
28 0.14
29 0.15
30 0.18
31 0.24
32 0.23
33 0.22
34 0.23
35 0.26
36 0.25
37 0.25
38 0.27
39 0.25
40 0.25
41 0.24
42 0.25
43 0.21
44 0.2
45 0.21
46 0.17
47 0.13
48 0.13
49 0.11
50 0.09
51 0.1
52 0.09
53 0.14
54 0.13
55 0.14
56 0.13
57 0.13
58 0.13
59 0.14
60 0.17
61 0.12
62 0.2
63 0.3
64 0.35
65 0.43
66 0.48
67 0.54
68 0.56
69 0.61
70 0.63
71 0.63
72 0.69
73 0.73
74 0.78
75 0.8
76 0.82
77 0.79
78 0.73
79 0.65
80 0.62
81 0.56
82 0.55
83 0.53
84 0.48
85 0.47
86 0.46
87 0.45
88 0.39
89 0.35
90 0.26
91 0.25
92 0.27
93 0.29
94 0.3
95 0.34
96 0.33
97 0.37
98 0.38
99 0.37
100 0.37
101 0.4
102 0.41
103 0.42
104 0.45
105 0.49
106 0.48
107 0.48
108 0.46
109 0.42
110 0.4
111 0.35
112 0.33
113 0.31
114 0.4
115 0.37
116 0.35
117 0.35
118 0.38
119 0.43
120 0.49
121 0.51
122 0.44
123 0.43
124 0.44
125 0.47
126 0.47
127 0.46
128 0.42
129 0.35
130 0.41
131 0.51
132 0.6
133 0.65
134 0.68
135 0.71
136 0.71
137 0.77
138 0.77
139 0.77
140 0.74
141 0.73
142 0.71
143 0.69
144 0.7
145 0.64
146 0.56
147 0.46
148 0.4
149 0.33
150 0.29
151 0.28