Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7B4D1

Protein Details
Accession A0A0D7B4D1    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
83-102YRKGIHKVPKWTRTTNRVNPHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23.5, cyto_mito 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR016340  Ribosomal_L31_mit  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0032543  P:mitochondrial translation  
Pfam View protein in Pfam  
PF09784  L31  
Amino Acid Sequences MFGPFRATSPTLGGLLWKIPWRLSTTRKANARHRLKKVDAVIEAVRASGVQCEALTQALELPKEHEMHPRDKYTTFAARAKGYRKGIHKVPKWTRTTNRVNPTGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.15
3 0.16
4 0.16
5 0.15
6 0.16
7 0.18
8 0.22
9 0.28
10 0.32
11 0.4
12 0.44
13 0.51
14 0.57
15 0.63
16 0.67
17 0.71
18 0.76
19 0.75
20 0.75
21 0.75
22 0.71
23 0.7
24 0.65
25 0.59
26 0.48
27 0.43
28 0.35
29 0.28
30 0.25
31 0.19
32 0.15
33 0.09
34 0.09
35 0.05
36 0.05
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.04
44 0.06
45 0.07
46 0.07
47 0.07
48 0.09
49 0.11
50 0.12
51 0.13
52 0.19
53 0.21
54 0.27
55 0.32
56 0.33
57 0.34
58 0.33
59 0.35
60 0.33
61 0.36
62 0.35
63 0.34
64 0.34
65 0.35
66 0.39
67 0.41
68 0.44
69 0.43
70 0.45
71 0.46
72 0.5
73 0.54
74 0.6
75 0.63
76 0.66
77 0.71
78 0.74
79 0.75
80 0.78
81 0.78
82 0.77
83 0.81
84 0.8
85 0.79