Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D7B151

Protein Details
Accession A0A0D7B151    Localization Confidence Low Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
18-38MPPPDHSRKPLKRKLPVNDQSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 9, cyto_nucl 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR028012  Rua1_C  
Pfam View protein in Pfam  
PF14616  Rua1_C  
Amino Acid Sequences SYHMQHVHGISAATLRPMPPPDHSRKPLKRKLPVNDQSKIHGFCGSCQQWVCVEGETELKVPEIVWWKHARACQLNSLAPKLKPCDKRRVV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.11
3 0.14
4 0.16
5 0.18
6 0.23
7 0.31
8 0.37
9 0.46
10 0.51
11 0.59
12 0.66
13 0.74
14 0.77
15 0.78
16 0.79
17 0.78
18 0.81
19 0.81
20 0.8
21 0.76
22 0.72
23 0.64
24 0.59
25 0.54
26 0.47
27 0.37
28 0.31
29 0.24
30 0.2
31 0.27
32 0.24
33 0.21
34 0.2
35 0.2
36 0.17
37 0.18
38 0.18
39 0.1
40 0.1
41 0.08
42 0.1
43 0.1
44 0.1
45 0.09
46 0.08
47 0.08
48 0.08
49 0.1
50 0.17
51 0.16
52 0.21
53 0.24
54 0.26
55 0.3
56 0.32
57 0.36
58 0.35
59 0.37
60 0.4
61 0.41
62 0.44
63 0.43
64 0.47
65 0.45
66 0.4
67 0.42
68 0.42
69 0.46
70 0.52
71 0.55