Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7B8J8

Protein Details
Accession A0A0D7B8J8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-89ILSQLFWHRQRRRGAHRRTRASLDVHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 10extr 10, E.R. 4, mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MGNTCEIFVVTPVPLVVCSAATVVSDTGGGRELMDFSSQRCRFCRAYNTNFACVGCGTPVYISSILSQLFWHRQRRRGAHRRTRASLDVPELL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.08
3 0.08
4 0.06
5 0.06
6 0.06
7 0.06
8 0.06
9 0.07
10 0.06
11 0.06
12 0.06
13 0.06
14 0.06
15 0.07
16 0.06
17 0.06
18 0.06
19 0.06
20 0.06
21 0.08
22 0.08
23 0.09
24 0.19
25 0.21
26 0.23
27 0.24
28 0.28
29 0.29
30 0.32
31 0.41
32 0.39
33 0.43
34 0.5
35 0.52
36 0.49
37 0.48
38 0.43
39 0.34
40 0.26
41 0.21
42 0.11
43 0.08
44 0.06
45 0.05
46 0.06
47 0.08
48 0.08
49 0.08
50 0.09
51 0.11
52 0.1
53 0.11
54 0.11
55 0.12
56 0.2
57 0.26
58 0.35
59 0.4
60 0.47
61 0.56
62 0.65
63 0.73
64 0.75
65 0.8
66 0.81
67 0.86
68 0.88
69 0.85
70 0.82
71 0.76
72 0.71
73 0.65