Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BAC7

Protein Details
Accession A0A0D7BAC7   
Localization Confidence Low
Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
12-45GKVKSQCPKVEKQEKKKTPKGRAKKRIVYNRRFVBasic
NLS Segment(s)
PositionSequence
20-37KVEKQEKKKTPKGRAKKR
Subcellular Location(s) mito 17.5, mito_nucl 11.833, cyto_nucl 5.333, nucl 5, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MGKVHGSLARAGKVKSQCPKVEKQEKKKTPKGRAKKRIVYNRRFVNVTTLPGGKRRMWVTVLRRVPAPFPCAPDDPEYHA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.42
2 0.45
3 0.5
4 0.51
5 0.54
6 0.62
7 0.65
8 0.71
9 0.73
10 0.76
11 0.79
12 0.82
13 0.86
14 0.87
15 0.86
16 0.86
17 0.87
18 0.87
19 0.87
20 0.88
21 0.88
22 0.88
23 0.88
24 0.88
25 0.87
26 0.83
27 0.8
28 0.75
29 0.68
30 0.6
31 0.5
32 0.47
33 0.38
34 0.33
35 0.27
36 0.24
37 0.22
38 0.25
39 0.28
40 0.22
41 0.25
42 0.24
43 0.25
44 0.26
45 0.33
46 0.36
47 0.42
48 0.45
49 0.42
50 0.43
51 0.42
52 0.43
53 0.39
54 0.39
55 0.32
56 0.32
57 0.35
58 0.35
59 0.37
60 0.38