Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

B2W1M5

Protein Details
Accession B2W1M5    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
20-44RLRTGHRCRRSIRPRPSRRLEQQDHBasic
NLS Segment(s)
Subcellular Location(s) mito 11, nucl 6.5, cyto_nucl 6, cyto 4.5, extr 4
Family & Domain DBs
Amino Acid Sequences MAVISVTASYCRAARDCSDRLRTGHRCRRSIRPRPSRRLEQQDHPIHPPDPHQENQHFRSHARYSVATPLQVHRQQHRNPTHWLSCGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.26
3 0.31
4 0.37
5 0.43
6 0.43
7 0.44
8 0.51
9 0.56
10 0.6
11 0.64
12 0.64
13 0.65
14 0.66
15 0.75
16 0.76
17 0.77
18 0.77
19 0.79
20 0.81
21 0.84
22 0.87
23 0.85
24 0.83
25 0.83
26 0.77
27 0.72
28 0.72
29 0.69
30 0.63
31 0.56
32 0.5
33 0.41
34 0.36
35 0.32
36 0.28
37 0.26
38 0.26
39 0.29
40 0.33
41 0.39
42 0.43
43 0.46
44 0.41
45 0.37
46 0.42
47 0.39
48 0.37
49 0.34
50 0.31
51 0.27
52 0.34
53 0.35
54 0.3
55 0.29
56 0.29
57 0.34
58 0.37
59 0.4
60 0.39
61 0.47
62 0.51
63 0.6
64 0.65
65 0.61
66 0.64
67 0.68
68 0.66