Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D7BSV4

Protein Details
Accession A0A0D7BSV4   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-89RDSRDRGRERHHRSRDRPRSRDRRETGKDGBasic
NLS Segment(s)
PositionSequence
38-92NGPPRNKPGLGYDHRDRDRDRERDSRDRGRERHHRSRDRPRSRDRRETGKDGLKR
Subcellular Location(s) nucl 22.5, cyto_nucl 13, cyto 2.5
Family & Domain DBs
Amino Acid Sequences MTNLSAGVKRAHEDRDSNSGRKRQRDDSRDWKDTHLKNGPPRNKPGLGYDHRDRDRDRERDSRDRGRERHHRSRDRPRSRDRRETGKDGLKRQHEKLHQSHEDVEEGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.4
3 0.44
4 0.47
5 0.51
6 0.54
7 0.57
8 0.62
9 0.63
10 0.63
11 0.68
12 0.69
13 0.71
14 0.75
15 0.77
16 0.74
17 0.7
18 0.65
19 0.64
20 0.6
21 0.59
22 0.55
23 0.51
24 0.53
25 0.61
26 0.64
27 0.6
28 0.63
29 0.61
30 0.55
31 0.51
32 0.47
33 0.46
34 0.41
35 0.43
36 0.42
37 0.44
38 0.44
39 0.45
40 0.42
41 0.41
42 0.46
43 0.44
44 0.46
45 0.45
46 0.51
47 0.58
48 0.64
49 0.65
50 0.65
51 0.68
52 0.66
53 0.67
54 0.7
55 0.71
56 0.75
57 0.76
58 0.78
59 0.79
60 0.87
61 0.89
62 0.89
63 0.89
64 0.89
65 0.9
66 0.88
67 0.9
68 0.84
69 0.84
70 0.8
71 0.78
72 0.75
73 0.73
74 0.71
75 0.68
76 0.7
77 0.69
78 0.68
79 0.66
80 0.67
81 0.65
82 0.68
83 0.68
84 0.7
85 0.65
86 0.63
87 0.63
88 0.56